Angiotensin II serves as the ligand for the class of G protein-coupled receptors known as angiotensin receptors. They play a crucial role in the renin-angiotensin system as they are involved in the signal transduction of the main effector hormone, angiotensin II's, vasoconstricting stimulus. Angiotensin II, their primary ligand, has a similar affinity for the AT1 and AT2 receptors. The angiotensin receptor that has been most thoroughly characterized is AT1. The fetus and newborn have a higher concentration of AT2 receptors. The AT3 and AT4 receptors are additional understudied subtypes.
Structure | Cat No. | Product Name | CAS No. | Product Description |
---|---|---|---|---|
V75287 | Losartan-d9 (Losartan-d9; DuP-753-d9) | 1030937-18-8 | Losartan-d9 is the deuterated form of Losartan. | |
V80603 | Mepixelil | Mepixetil is a potent angiotensin II receptor antagonist. | ||
V76753 | Mopivabil | Mopivabil is an angiotensin II receptor blocker (antagonist). | ||
V76724 | N-Acetyl-Ser-Asp-Lys-Pro acetate (Ac-SDKP acetate) | N-Acetyl-Ser-Asp-Lys-Pro (Ac-SDKP) acetate is a specific substrate for the N-terminal active site of angiotensin-converting enzyme (ACE). | ||
V76723 | N-Acetyl-Ser-Asp-Lys-Pro TFA (Ac-SDKP TFA) | N-Acetyl-Ser-Asp-Lys-Pro (TFA) is an endogenous tetrapeptide from bone marrow and is a specific substrate for the N-terminal site of ACE. | ||
V76694 | NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ | NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an ACE (angiotensin-converting enzyme) 2 (ACE2)-related peptide that may be utilized to study the function of ACE2. | ||
V76691 | Norleual TFA | Norleual TFA is an angiotensin (Ang) IV analog and a hepatocyte growth factor (HGF)/c-Met inhibitor (antagonist) with IC50 of 3 pM. | ||
V75286 | Novokinin TFA | 1262750-59-3 | Novokinin TFA is a bioactive peptide agonist of the angiotensin AT2 receptor. | |
V5109 | Olmesartan (RNH-6270; CS-866) | 144689-24-7 | Olmesartan (formerly also known as CS-866) is a potent and selective angiotensin II type 1 (AT(1)) receptor antagonist used in the treatment of high blood pressure. | |
V75297 | Olmesartan impurity | 154709-18-9 | Olmesartan impurity is the impurity of Olmesartan. | |
V75283 | Olmesartan lactone impurity | 849206-43-5 | Olmesartan impurity is the cyclic ester impurity of Olmesartan. | |
V75298 | Olmesartan medoxomil impurity C (Dehydro Olmesartan medoxomil) | 879562-26-2 | Olmesartan medoxomil impurity C is the impurity of Olmesartan medoxomil. | |
V75303 | Olmesartan methyl ester | 1347262-29-6 | Olmesartan methyl ester is an intermediate in the synthesis/preparation of Olmesartan medoxomil. | |
V4820 | Olodanrigan (PD126055; EMA 401) | 1316755-16-4 | Olodanrigan (EMA-401; PD-126055; EMA401) is a novel, orally bioavailable, peripherally restricted and highly selective AT2R (angiotensin II type 2 receptor) antagonist that can be potentially used for treatment of postherpetic neuralgia (PHN). | |
V2884 | PD-123319 TFA salt | 136676-91-0 | PD 123319 ditrifluoroacetate is a novel, potent, and selective nonpeptide AT2 (angiotensin II) receptor antagonist with IC50 of 34 nM. | |
V3515 | Sparsentan | 254740-64-2 | Sparsentan (formerly known as PS433540; BMS-346567; RE-021; DARA-a) is a novel, highly potent dualantagonist of angiotensin IIandendothelin Areceptor for the treatment of IgA nephropathy (IgAN). | |
V76477 | STIEEQAKTFLDKFNHEAEDLFYQSSLASWN | STIEEQAKTFLDKFNHEAEDLFYQSSLASWN is an ACE (angiotensin-converting enzyme) 2 (ACE2)-related peptide that may be utilized to study the function of ACE2. | ||
V5003 | Tasosartan | 145733-36-4 | Tasosartan (ANA-756, AC1Q6LAA, DB01349, WAY-ANA-756, Verdia) is a pyrido-pyrimidin-based and long-acting antagonist of angiotensin II (AngII) receptor with anti-hypertensive effects. | |
V81553 | Telmisartan-d4 (telmisartan d4) | Telmisartan-d4 is the deuterated form of Telmisartan. | ||
V3309 | tranilast | 53902-12-8 | Tranilast (also known as MK 341; SB 252218; trade name Rizaben),an analog of a tryptophan metabolite, is an antiallergic drug developed by Kissei Pharmaceuticals and was approved in 1982 for use in Japan and South Korea for bronchial asthma. |