yingweiwo

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ

Cat No.:V76694 Purity: ≥98%
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an ACE (angiotensin-converting enzyme) 2 (ACE2)-related peptide that may be utilized to study the function of ACE2.
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ Chemical Structure Product category: Angiotensin Receptor
This product is for research use only, not for human use. We do not sell to patients.
Size Price Stock Qty
1mg
5mg
Other Sizes
Official Supplier of:
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text

 

  • Business Relationship with 5000+ Clients Globally
  • Major Universities, Research Institutions, Biotech & Pharma
  • Citations by Top Journals: Nature, Cell, Science, etc.
Top Publications Citing lnvivochem Products
Product Description
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an ACE (angiotensin-converting enzyme) 2 (ACE2)-related peptide that may be utilized to study the function of ACE2.
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is a synthetic, long-chain peptide corresponding to a significant fragment of the human Angiotensin-Converting Enzyme 2 (ACE2) extracellular domain. ACE2 is a type I transmembrane protein that serves as a critical regulator of the renin-angiotensin system (RAS). This peptide, with a molecular weight of 4835.47 g/mol and formula C213H342N58O66S2, is supplied as a research-grade TFA salt to enhance its solubility and stability. It is primarily utilized as a research tool to study the function of ACE2, particularly its interactions with other proteins and its role in catalyzing the conversion of angiotensin II (Ang II) to the vasodilator angiotensin (1-7) (Ang 1-7).
Biological Activity I Assay Protocols (From Reference)
Targets
This peptide is an ACE2-related peptide that spans a large portion of its N-terminal extracellular catalytic domain. Its primary utility is as a binding substrate or epitope for studying the interaction between ACE2 and other proteins, such as the SARS-CoV-2 spike protein or natural ligands like angiotensin II. While not an inhibitor itself, it can be used in competition assays to map binding sites. The parent protein, ACE2, is a zinc metalloprotease whose main physiological targets are Ang II and Ang I. By converting Ang II (a potent vasoconstrictor) into Ang 1-7 (a vasodilator), ACE2 plays a crucial counter-regulatory role within the RAS, protecting against hypertension, heart failure, and lung injury. This long peptide allows researchers to explore these binding and catalytic properties in a simplified, cell-free system.
ln Vitro
No specific in vitro activity data for this exact peptide is available in the search results. However, the in vitro activity of the full-length ACE2 protein is well-established. Recombinant human ACE2 (rhACE2) is known to efficiently cleave the C-terminal phenylalanine residue from its substrate, Angiotensin II, to produce Angiotensin (1-7). The enzymatic activity of the ACE2 protein can be measured using fluorogenic peptide substrates, such as Mca-APK(Dnp)-OH, which fluoresces upon cleavage. This particular long peptide, representing the receptor binding domain (RBD), is more likely to be used in binding studies rather than enzymatic activity assays. It may interact with the natural ligands of ACE2, potentially blocking their binding to the active site.
ln Vivo
No specific in vivo data for this peptide is available. The biological effects of the full-length ACE2 protein, however, are extensively characterized. Genetic deletion (knockout) of Ace2 in mice results in severe angiotensin II-dependent cardiac contractility defects, hypertension, and increased susceptibility to lung injury. Conversely, overexpression of ACE2 or administration of recombinant ACE2 is protective in animal models of hypertension, atherosclerosis, and acute respiratory distress syndrome (ARDS). The peptide may be used in vivo to block the interaction between viral proteins and ACE2, although its efficacy is not documented. Because it is a fragment, its in vivo activity is expected to be as a competitive binding agent rather than a catalytic enzyme.
Enzyme Assay
A cell-free ELISA binding assay can be used to study the interaction of this ACE2 peptide with other proteins. A 96-well plate is coated with 1-5 microg/mL of the ACE2 peptide in coating buffer overnight at 4degC. The plate is then blocked with 3% BSA in PBS-T (0.05% Tween-20) for 1 hour at room temperature. Serially diluted recombinant SARS-CoV-2 spike protein (S1 subunit or RBD domain, 0.01-100 microg/mL) is added to the wells and incubated for 2 hours at 37degC. After washing, the plate is incubated with an HRP-conjugated antibody specific for the His-tag of the spike protein. The signal is developed with TMB substrate, stopped with H2SO4, and the absorbance is read at 450 nm. This protocol is used to map the interaction between the ACE2 receptor and the virus, and the long peptide can be used as a blocking reagent to test the specificity of the interaction.
Cell Assay
A specific cell-based protocol for this exact peptide is not well-documented. However, researchers can perform a cell-based flow cytometry binding assay. ACE2-expressing cells, such as HEK293 cells transiently transfected with an ACE2 expression plasmid or naturally expressing A549 human lung epithelial cells, are detached and resuspended in FACS buffer (PBS + 1% BSA). The cells are then incubated with varying concentrations of the ACE2-related peptide (e.g., 0.1-100 microM) on ice for 30 minutes. After washing, the bound peptide can be detected using a primary antibody specific for the peptide's sequence (if available) followed by a fluorescently-labeled secondary antibody. Alternatively, the biotinylated form of the peptide can be used, followed by detection with Streptavidin-PE. The cells are then analyzed by flow cytometry. A shift in mean fluorescence intensity (MFI) indicates binding. This experiment can be used to determine the Kd of the peptide for the ACE2 receptor on the cell surface.
Animal Protocol
An in vivo protocol for this peptide might involve a xenograft mouse model for imaging studies. For an imaging experiment, the peptide could be conjugated to a near-infrared (NIR) dye (e.g., Cy5.5 or IRDye 800CW) to create an optical tracer. To study ACE2 expression in tumors or inflammation, female BALB/c nude mice (6-8 weeks) are injected subcutaneously with 5×10⁶ ACE2-positive tumor cells (e.g., A549 lung cancer cells). When the tumor volume reaches 200-300 mm3, the labeled peptide (5-10 mg/kg) is administered intravenously via the tail vein. In vivo imaging is performed using an IVIS Spectrum or similar imaging system at various time points (0, 1, 2, 4, 6, 8, 24 hours post-injection). The region of interest (ROI) is measured to quantify the fluorescence intensity in the tumor, and blocking studies with an excess of unlabeled peptide (50-100 mg/kg) are used to confirm specificity. Ex vivo biodistribution is performed at the end of the experiment.
ADME/Pharmacokinetics
This product is a lyophilized white to off-white solid powder with high purity (≥98%). It should be stored in a sealed container at -20degC, protected from moisture, where it is stable for up to 3 years. For long-term storage of solutions, it is recommended to store at -80degC for up to 6 months. It is soluble in DMSO at ~33.33 mg/mL (~6.89 mM). For in vivo administration, a formulation protocol is available: the peptide can be dissolved to ≥ 2.5 mg/mL (0.52 mM) in a solution of 10% DMSO + 40% PEG300 + 5% Tween80 + 45% Saline, creating a clear solution suitable for injection. Because of its high molecular weight (4835.47 g/mol), it will have a relatively long half-life in circulation but will primarily be cleared by the reticuloendothelial system.
Toxicity/Toxicokinetics
This product is for research use only and is not intended for diagnostic or therapeutic use in humans. As a research-grade peptide with a TFA salt, no specific toxicity data is available. The TFA counterion can be problematic in cell culture if the concentration exceeds 0.1%, but for most in vivo and in vitro applications, this is not an issue at working dilutions. Standard laboratory safety practices, including the use of personal protective equipment (PPE) such as gloves and safety glasses, should be followed. The primary caution is that, due to its long sequence, handling and storage must be carefully managed to avoid degradation and aggregation of the peptide.
Additional Infomation
This long-chain peptide (the sequence is 36 amino acids long) is a research tool designed for studying protein-protein interactions involving ACE2. The human ACE2 protein is a critical component of the Renin-Angiotensin-Aldosterone System (RAAS), counterbalancing ACE by degrading Angiotensin II, a potent vasoconstrictor, into Angiotensin 1-7, a vasodilator. This peptide is derived from the region that interacts with viral spike proteins, making it highly relevant for research related to infectious diseases. The TFA salt form is a common synthetic counterion used to improve the physicochemical properties of peptides for research applications. The peptide's high molecular weight (approx. 4835 Da) is typical of large synthetic fragments used in protein interaction studies.
These protocols are for reference only. InvivoChem does not independently validate these methods.
Physicochemical Properties
Molecular Formula
C213H342N58O66S2
Molecular Weight
4835.47
Appearance
White to off-white solid powder
HS Tariff Code
2934.99.9001
Storage

Powder      -20°C    3 years

                     4°C     2 years

In solvent   -80°C    6 months

                  -20°C    1 month

Note: Please store this product in a sealed and protected environment, avoid exposure to moisture.
Shipping Condition
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
Solubility Data
Solubility (In Vitro)
DMSO :~33.33 mg/mL (~6.89 mM)
Solubility (In Vivo)
Solubility in Formulation 1: ≥ 2.5 mg/mL (0.52 mM) (saturation unknown) in 10% DMSO + 40% PEG300 + 5% Tween80 + 45% Saline (add these co-solvents sequentially from left to right, and one by one), clear solution.
For example, if 1 mL of working solution is to be prepared, you can add 100 μL of 25.0 mg/mL clear DMSO stock solution to 400 μL PEG300 and mix evenly; then add 50 μL Tween-80 to the above solution and mix evenly; then add 450 μL normal saline to adjust the volume to 1 mL.
Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH₂ O to obtain a clear solution.

Solubility in Formulation 2: ≥ 2.5 mg/mL (0.52 mM) (saturation unknown) in 10% DMSO + 90% Corn Oil (add these co-solvents sequentially from left to right, and one by one), clear solution.
For example, if 1 mL of working solution is to be prepared, you can add 100 μL of 25.0 mg/mL clear DMSO stock solution to 900 μL of corn oil and mix evenly.

 (Please use freshly prepared in vivo formulations for optimal results.)
Preparing Stock Solutions 1 mg 5 mg 10 mg
1 mM 0.2068 mL 1.0340 mL 2.0681 mL
5 mM 0.0414 mL 0.2068 mL 0.4136 mL
10 mM 0.0207 mL 0.1034 mL 0.2068 mL

*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.

Calculator

Molarity Calculator allows you to calculate the mass, volume, and/or concentration required for a solution, as detailed below:

  • Calculate the Mass of a compound required to prepare a solution of known volume and concentration
  • Calculate the Volume of solution required to dissolve a compound of known mass to a desired concentration
  • Calculate the Concentration of a solution resulting from a known mass of compound in a specific volume
An example of molarity calculation using the molarity calculator is shown below:
What is the mass of compound required to make a 10 mM stock solution in 5 ml of DMSO given that the molecular weight of the compound is 350.26 g/mol?
  • Enter 350.26 in the Molecular Weight (MW) box
  • Enter 10 in the Concentration box and choose the correct unit (mM)
  • Enter 5 in the Volume box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 17.513 mg appears in the Mass box. In a similar way, you may calculate the volume and concentration.

Dilution Calculator allows you to calculate how to dilute a stock solution of known concentrations. For example, you may Enter C1, C2 & V2 to calculate V1, as detailed below:

What volume of a given 10 mM stock solution is required to make 25 ml of a 25 μM solution?
Using the equation C1V1 = C2V2, where C1=10 mM, C2=25 μM, V2=25 ml and V1 is the unknown:
  • Enter 10 into the Concentration (Start) box and choose the correct unit (mM)
  • Enter 25 into the Concentration (End) box and select the correct unit (mM)
  • Enter 25 into the Volume (End) box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 62.5 μL (0.1 ml) appears in the Volume (Start) box
g/mol

Molecular Weight Calculator allows you to calculate the molar mass and elemental composition of a compound, as detailed below:

Note: Chemical formula is case sensitive: C12H18N3O4  c12h18n3o4
Instructions to calculate molar mass (molecular weight) of a chemical compound:
  • To calculate molar mass of a chemical compound, please enter the chemical/molecular formula and click the “Calculate’ button.
Definitions of molecular mass, molecular weight, molar mass and molar weight:
  • Molecular mass (or molecular weight) is the mass of one molecule of a substance and is expressed in the unified atomic mass units (u). (1 u is equal to 1/12 the mass of one atom of carbon-12)
  • Molar mass (molar weight) is the mass of one mole of a substance and is expressed in g/mol.
/

Reconstitution Calculator allows you to calculate the volume of solvent required to reconstitute your vial.

  • Enter the mass of the reagent and the desired reconstitution concentration as well as the correct units
  • Click the “Calculate” button
  • The answer appears in the Volume (to add to vial) box
In vivo Formulation Calculator (Clear solution)
Step 1: Enter information below (Recommended: An additional animal to make allowance for loss during the experiment)
Step 2: Enter in vivo formulation (This is only a calculator, not the exact formulation for a specific product. Please contact us first if there is no in vivo formulation in the solubility section.)
+
+
+

Calculation results

Working concentration mg/mL;

Method for preparing DMSO stock solution mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.

Method for preparing in vivo formulation:Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O,mix and clarify.

(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
             (2) Be sure to add the solvent(s) in order.

Contact Us