| Size | Price | Stock | Qty |
|---|---|---|---|
| 1mg |
|
||
| 5mg |
|
||
| 10mg |
|
||
| Other Sizes |
| Targets |
Angiotensin-converting enzyme 2 (ACE2). STIEEQAKTFLDKFNHEAEDLFYQSSLASWN is an ACE2-related peptide that may interact with or mimic the functions of ACE2. ACE2 is a key regulator of the renin-angiotensin system (RAS), converting angiotensin II to angiotensin (1-7), thereby counteracting the vasoconstrictive effects of ACE. The peptide is utilized to study ACE2 function.
|
|---|---|
| ln Vitro |
This ACE2-related peptide is used in biochemical and structural biology studies to investigate protein-peptide interactions and epitope mapping. It may help elucidate the molecular details of ACE2 interactions with its substrates and binding partners, including the SARS-CoV-2 spike protein, as ACE2 is the primary receptor for the virus.
|
| ln Vivo |
Not applicable. This peptide is a research tool for in vitro studies of ACE2 structure and function. It is not administered to animals for efficacy studies. It may be used in cell-based assays to study ACE2-mediated processes such as angiotensin II metabolism and downstream signaling.
|
| Enzyme Assay |
Not applicable. This compound is a synthetic peptide used for structural studies and protein interaction mapping. It can be used in surface plasmon resonance (SPR) experiments with immobilized recombinant ACE2 protein to study binding kinetics. Increasing concentrations of the peptide (0-1000 nM) are injected, and binding is measured.
|
| Cell Assay |
ACE2 activity assay: HEK293 cells overexpressing ACE2 are seeded in 96-well plates. Cells are treated with the ACE2-related peptide (0-1000 nM) for 24 h. Culture supernatants are collected, and ACE2 enzymatic activity is measured by incubating with a fluorogenic ACE2 substrate (e.g., Mca-APK(Dnp)-OH) for 30-60 min at 37degC. Fluorescence is measured (ex=320 nm, em=405 nm). Alternatively, the peptide can be used to block ACE2-ligand interactions.
|
| Animal Protocol |
Not applicable. The peptide is not used for in vivo animal studies as a drug candidate.
|
| ADME/Pharmacokinetics |
Pharmacokinetic data for this 31-amino acid peptide (MW 3649.88) are not available, as it is a research tool for in vitro studies. It has poor oral bioavailability and a short plasma half-life due to proteolytic degradation. It is typically dissolved in DMSO or water for cell-based assays. The powder should be stored at -20degC in a sealed, protected environment.
|
| Toxicity/Toxicokinetics |
Toxicity data for this ACE2-related peptide are not reported. It is intended for research use only and not for human or animal consumption. At standard assay concentrations (1-1000 nM), no cytotoxicity has been reported. Standard safety precautions for handling synthetic peptides should be followed.
|
| References | |
| Additional Infomation |
This ACE2-related peptide is a research tool for studying ACE2 function, structure, and interactions. It is not a drug candidate and has no therapeutic indications. It may be useful for understanding ACE2-mediated processes in cardiovascular disease and SARS-CoV-2 infection. The sequence is 31 amino acids long. For research use only.
|
| Molecular Formula |
C164H238N40O55
|
|---|---|
| Molecular Weight |
3649.88
|
| Appearance |
White to off-white solid powder
|
| HS Tariff Code |
2934.99.9001
|
| Storage |
Powder -20°C 3 years 4°C 2 years In solvent -80°C 6 months -20°C 1 month Note: Please store this product in a sealed and protected environment, avoid exposure to moisture. |
| Shipping Condition |
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
|
| Solubility (In Vitro) |
May dissolve in DMSO (in most cases), if not, try other solvents such as H2O, Ethanol, or DMF with a minute amount of products to avoid loss of samples
|
|---|---|
| Solubility (In Vivo) |
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.
Injection Formulations
Injection Formulation 1: DMSO : Tween 80： Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution → 50 μL Tween 80 → 850 μL Saline)(e.g. IP/IV/IM/SC) *Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution. Injection Formulation 2: DMSO : PEG300 ：Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO → 400 μLPEG300 → 50 μL Tween 80 → 450 μL Saline) Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO → 900 μL Corn oil) Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals). View More
Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO → 900 μL (20% SBE-β-CD in saline)] Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium) Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals). View More
Oral Formulation 3: Dissolved in PEG400 (Please use freshly prepared in vivo formulations for optimal results.) |
| Preparing Stock Solutions | 1 mg | 5 mg | 10 mg | |
| 1 mM | 0.2740 mL | 1.3699 mL | 2.7398 mL | |
| 5 mM | 0.0548 mL | 0.2740 mL | 0.5480 mL | |
| 10 mM | 0.0274 mL | 0.1370 mL | 0.2740 mL |
*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.
Calculation results
Working concentration： mg/mL；
Method for preparing DMSO stock solution： mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.
Method for preparing in vivo formulation:：Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O，mix and clarify.
(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
(2) Be sure to add the solvent(s) in order.
Products are for research use only; We do not sell to patients
Copyright 2020 InvivoChem LLC | All Rights Reserved
