| Size | Price | Stock | Qty |
|---|---|---|---|
| 1mg |
|
||
| 5mg |
|
||
| 10mg |
|
||
| Other Sizes |
| ln Vitro |
B-type natriuretic peptide (BNP) counteracts cardiac stress by lowering blood pressure and reducing ventricular fibrosis. Rat BNP(1-32) (rBNP(1-32)) is an amino-truncated form of natural rat BNP with 45 amino acid residues [1]. Atrial natriuretic peptide-(1-28) (ANP), brain natriuretic peptide-(1-32) (BNP) and C-type natriuretic peptide (CNP) are present in the brain, mainly concentrated in the anterior ventral region of the third ventricle, and are involved in the regulation of fluid balance. ANP(1-28), BNP(1-32) and CNP(1-32) play a role in regulating salt and water balance in the mammalian brain through their receptors NPR-A and NPR-B [2].
|
|---|---|
| ln Vivo |
This study compared the antihypertensive, natriuretic, and cGMP responses of several brain natriuretic peptides (BNPs) and atrial natriuretic peptide (ANP) 99-126 in conscious spontaneously hypertensive rats (SHR) and conscious cynomolgus monkeys (treated with a vector or the selective neutral endopeptidase inhibitor SQ 28603, respectively). In conscious SHR, intravenous injection of 3 nmol/kg rat BNP (1-32) induced stronger natriuretic and cGMP responses than rat ANP 99-126 and porcine BNP-26, and intravenous injection of 100 μmol/kg SQ 28603 significantly enhanced these responses. Human BNP-32 was inactive in SHR treated with either the vector or SQ 28603. In contrast, intravenous injection of human BNP (1-32) at 1 nmol/kg stimulated awake monkeys to produce renal and hypotensive responses greater than or equal to human ANP 99-126, while intravenous injection of BNP (1-32) at 3 nmol/kg reduced mean arterial pressure in rats without affecting renal function [3].
|
| References |
|
| Molecular Formula |
C148H243N47O46S3
|
|---|---|
| Molecular Weight |
3512.99
|
| Related CAS # |
Brain Natriuretic Peptide (1-32), rat
|
| Sequence |
Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys10-Cys26)NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys10-Cys26)
|
| SequenceShortening |
NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys10-Cys26)
|
| Appearance |
White to off-white solid
|
| Synonyms |
BNP (1-32), rat acetate
|
| HS Tariff Code |
2934.99.9001
|
| Storage |
Powder -20°C 3 years 4°C 2 years In solvent -80°C 6 months -20°C 1 month Note: 请将本产品存放在密封保护的环境中，避免受潮。 |
| Shipping Condition |
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
|
| Solubility (In Vitro) |
H2O
|
|---|---|
| Solubility (In Vivo) |
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.
Injection Formulations
Injection Formulation 1: DMSO : Tween 80： Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution → 50 μL Tween 80 → 850 μL Saline)(e.g. IP/IV/IM/SC) *Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution. Injection Formulation 2: DMSO : PEG300 ：Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO → 400 μLPEG300 → 50 μL Tween 80 → 450 μL Saline) Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO → 900 μL Corn oil) Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals). View More
Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO → 900 μL (20% SBE-β-CD in saline)] Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium) Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals). View More
Oral Formulation 3: Dissolved in PEG400 (Please use freshly prepared in vivo formulations for optimal results.) |
| Preparing Stock Solutions | 1 mg | 5 mg | 10 mg | |
| 1 mM | 0.2847 mL | 1.4233 mL | 2.8466 mL | |
| 5 mM | 0.0569 mL | 0.2847 mL | 0.5693 mL | |
| 10 mM | 0.0285 mL | 0.1423 mL | 0.2847 mL |
*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.
Calculation results
Working concentration： mg/mL；
Method for preparing DMSO stock solution： mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.
Method for preparing in vivo formulation:：Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O，mix and clarify.
(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
(2) Be sure to add the solvent(s) in order.
Products are for research use only; We do not sell to patients
Copyright 2020 InvivoChem LLC | All Rights Reserved
