yingweiwo

Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate)

Cat No.:V77186 Purity: ≥98%
Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate) is a polypeptide containing 32 amino acid (AA)s.
Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate)
Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate) Chemical Structure Product category: Angiotensin Receptor
This product is for research use only, not for human use. We do not sell to patients.
Size Price Stock Qty
1mg
5mg
Other Sizes

Other Forms of Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate):

  • 14-45-Brain natriureticpeptide-45 (rat) (9CI)
Official Supplier of:
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Top Publications Citing lnvivochem Products
Product Description
Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate) is a polypeptide containing 32 amino acid (AA)s. It could be utilized as a biochemical marker of morbidity and mortality in patients with heart failure.
Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate) is a 32-amino acid polypeptide hormone corresponding to the active, amino-truncated form of the 45-residue native rat BNP [20L17-L18]. It is synthesized by ventricular cardiomyocytes in response to myocardial stretch and is a key regulator of cardiovascular homeostasis [20L14-L16]. The acetate salt form enhances peptide stability and solubility for experimental use [7L15-L16]. This peptide is widely used in cardiovascular research to study heart failure, hypertension, and renal function [7L16-L18].
Biological Activity I Assay Protocols (From Reference)
Targets
This peptide targets natriuretic peptide receptors, specifically the guanylyl cyclase receptors natriuretic peptide receptor-A (NPR-A) and receptor-B (NPR-B) [7L22-L23]. By binding to these receptors, it activates an intracellular signaling cascade that produces the second messenger cyclic guanosine monophosphate (cGMP). Activation of this pathway leads to vasodilation, natriuresis (sodium excretion), diuresis (increased urine output), and inhibition of the renin-angiotensin-aldosterone system (RAAS) [7L14-L15].
ln Vitro
B-type natriuretic peptide (BNP) lowers blood pressure and ventricular fibrosis to counteract cardiac stress. An amino-truncated version of the 45-residue native rat form of BNP is known as rat BNP BNP(1-32) (rBNP(1-32)) [1]. The brain contains three natriuretic peptides that help regulate bodily fluid homeostasis: atrial natriuretic peptide (ANP), brain natriuretic peptide (BNP), and C-type natriuretic peptide (CNP). These peptides are concentrated in the anterior belly of the third ventricle area. In the mammalian brain, ANP(1-28), BNP(1-32), and CNP(1-32) control salt and water balance through their respective receptors, NPR-A and NPR-B [2].
In vitro, rat BNP (1-32) acts as a cardiac hormone that counteracts stress by reducing blood pressure and ventricular fibrosis [20L16-L17]. In cultured vascular smooth muscle cells or renal tubular cells, treatment with BNP leads to an increase in intracellular cGMP levels, which can be measured by ELISA. It also has potent vasodilatory activity in isolated blood vessel preparations, where it relaxes pre-constricted arteries in a concentration-dependent manner.
ln Vivo
to evaluate the effects of cyclic GMP, natriuretic agents, and antihypertensive drugs on various brain natriuretic peptides (BNP) and atrial natriuretic peptides (ANP). Rat BNP (1-32) 3 nmol/kg iv significantly increased the natriuretic and circulatory GMP responses in awake SHR compared to rat ANP 99-126 and pig BNP-26. It also increased the SQ 28,603 by 100 μmol/kg iv. When SHR was administered a vehicle or SQ 28,603, human BNP-32 was inactive. On the other hand, 3 nmol/kg iv rat BNP (1 -32) lowers mean arterial pressure without compromising renal function, while stimulation of the kidneys of conscious monkeys with 1 nmol/kg iv human BNP (1-32) produced depressed reactions greater than or equal to those elicited by human ANP 99-126 [3].
In vivo, rat BNP (1-32) has been shown to have potent natriuretic and depressor (blood pressure-lowering) effects. In a study in conscious spontaneously hypertensive rats (SHR), intravenous administration of 3 nmol/kg rat BNP (1-32) induced a significant increase in sodium excretion (natriuresis) and a decrease in mean arterial pressure [20L31-L34]. Interestingly, human BNP (1-32) was inactive in the SHR, highlighting the species specificity of natriuretic peptides.
Enzyme Assay
The binding of rat BNP (1-32) to its receptors (NPR-A and NPR-B) is typically assessed using radioligand binding assays on membrane preparations from cells overexpressing these receptors. Briefly, membranes are incubated with a fixed concentration of a radiolabeled natriuretic peptide (e.g., [¹2⁵I]-ANP) and increasing concentrations of unlabeled rat BNP (1-32) as a competitor. After incubation, the reaction mixture is filtered to separate bound from free radioligand, and the radioactivity on the filter is counted. The IC₅0 is calculated from the competition curve.
Cell Assay
Functional assays for rat BNP (1-32) are performed using cells expressing natriuretic peptide receptors, such as cultured rat vascular smooth muscle cells (VSMCs) or 293T cells transfected with NPR-A or NPR-B. Cells are treated with various concentrations of the peptide for 10-15 minutes. The primary endpoint is the production of intracellular cGMP, which can be quantified using a competitive ELISA kit. The half-maximal effective concentration (EC₅0) for cGMP accumulation is a measure of the peptide's potency.
Animal Protocol
In vivo rat studies are used to characterize the natriuretic and depressor activity of the peptide. For this procedure, a rat (e.g., a Sprague-Dawley or spontaneously hypertensive rat) is anesthetized, and catheters are placed in the femoral artery (for blood pressure monitoring) and bladder (for urine collection). A baseline period is established. The peptide is then administered as a bolus intravenous injection (e.g., 1-10 nmol/kg). Urine volume and sodium excretion are measured over time, and mean arterial pressure (MAP) is continuously recorded. The natriuretic and depressor responses are calculated compared to a vehicle control.
ADME/Pharmacokinetics
Pharmacokinetic (PK) data for rat BNP (1-32) is characteristic of a native peptide hormone. It has a very short half-life in the circulation (typically measured in minutes) due to rapid degradation by neutral endopeptidases (NEP) and clearance by the natriuretic peptide clearance receptor (NPR-C). Because of this short half-life, continuous infusion is often used in research settings to maintain stable plasma levels.
Toxicity/Toxicokinetics
Comprehensive toxicological data for rat BNP (1-32) are not detailed in standard product literature, as it is a naturally occurring peptide used for research. The parent, full-length BNP is an endogenous hormone and is generally well-tolerated at physiological concentrations. At research-use concentrations, no specific toxicities are reported. Standard peptide handling safety precautions, including the use of PPE, should be followed.
References

[1]. Human B-type natriuretic peptide is not degraded by meprin A. Biochem Pharmacol. 2010 Oct 1;80(7):1007-11.

[2]. Natriuretic peptides, but not nitric oxide donors, elevate levels of cytosolic guanosine 3',5'-cyclic monophosphate in ependymal cells ex vivo. Neurosci Lett. 2006 Jan 16;392(3):187-92.

[3]. Potentiation of brain natriuretic peptides by SQ 28,603, an inhibitor of neutral endopeptidase3.4.24.11, in monkeys and rats. J Pharmacol Exp Ther. 1992 Jul;262(1):60-70.

Additional Infomation
Brain Natriuretic Peptide (1-32), rat acetate (rBNP (1-32)) is an amino-truncated 32-amino acid form of the 45-residue natural rat BNP, with the sequence NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (disulfide bridge: Cys10-Cys26) [20L12-L13]. It has a molecular formula and weight as listed (approx. MW: 3512.99) [20L3-L4]. The peptide is stored at -20degC and shipped on blue ice [20L4-L7].
These protocols are for reference only. InvivoChem does not independently validate these methods.
Physicochemical Properties
Molecular Formula
C148H243N47O46S3
Molecular Weight
3512.99
Related CAS #
Brain Natriuretic Peptide (1-32), rat;133448-20-1
Appearance
Solid powder
HS Tariff Code
2934.99.9001
Storage

Powder      -20°C    3 years

                     4°C     2 years

In solvent   -80°C    6 months

                  -20°C    1 month

Note: Please store this product in a sealed and protected environment, avoid exposure to moisture.
Shipping Condition
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
Solubility Data
Solubility (In Vitro)
May dissolve in DMSO (in most cases), if not, try other solvents such as H2O, Ethanol, or DMF with a minute amount of products to avoid loss of samples
Solubility (In Vivo)
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.

Injection Formulations
(e.g. IP/IV/IM/SC)
Injection Formulation 1: DMSO : Tween 80: Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution 50 μL Tween 80 850 μL Saline)
*Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution.
Injection Formulation 2: DMSO : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO 400 μLPEG300 50 μL Tween 80 450 μL Saline)
Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO 900 μL Corn oil)
Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals).
View More

Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO 900 μL (20% SBE-β-CD in saline)]
*Preparation of 20% SBE-β-CD in Saline (4°C,1 week): Dissolve 2 g SBE-β-CD in 10 mL saline to obtain a clear solution.
Injection Formulation 5: 2-Hydroxypropyl-β-cyclodextrin : Saline = 50 : 50 (i.e. 500 μL 2-Hydroxypropyl-β-cyclodextrin 500 μL Saline)
Injection Formulation 6: DMSO : PEG300 : castor oil : Saline = 5 : 10 : 20 : 65 (i.e. 50 μL DMSO 100 μLPEG300 200 μL castor oil 650 μL Saline)
Injection Formulation 7: Ethanol : Cremophor : Saline = 10: 10 : 80 (i.e. 100 μL Ethanol 100 μL Cremophor 800 μL Saline)
Injection Formulation 8: Dissolve in Cremophor/Ethanol (50 : 50), then diluted by Saline
Injection Formulation 9: EtOH : Corn oil = 10 : 90 (i.e. 100 μL EtOH 900 μL Corn oil)
Injection Formulation 10: EtOH : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL EtOH 400 μLPEG300 50 μL Tween 80 450 μL Saline)


Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium)
Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose
Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals).
View More

Oral Formulation 3: Dissolved in PEG400
Oral Formulation 4: Suspend in 0.2% Carboxymethyl cellulose
Oral Formulation 5: Dissolve in 0.25% Tween 80 and 0.5% Carboxymethyl cellulose
Oral Formulation 6: Mixing with food powders


Note: Please be aware that the above formulations are for reference only. InvivoChem strongly recommends customers to read literature methods/protocols carefully before determining which formulation you should use for in vivo studies, as different compounds have different solubility properties and have to be formulated differently.

 (Please use freshly prepared in vivo formulations for optimal results.)
Preparing Stock Solutions 1 mg 5 mg 10 mg
1 mM 0.2847 mL 1.4233 mL 2.8466 mL
5 mM 0.0569 mL 0.2847 mL 0.5693 mL
10 mM 0.0285 mL 0.1423 mL 0.2847 mL

*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.

Calculator

Molarity Calculator allows you to calculate the mass, volume, and/or concentration required for a solution, as detailed below:

  • Calculate the Mass of a compound required to prepare a solution of known volume and concentration
  • Calculate the Volume of solution required to dissolve a compound of known mass to a desired concentration
  • Calculate the Concentration of a solution resulting from a known mass of compound in a specific volume
An example of molarity calculation using the molarity calculator is shown below:
What is the mass of compound required to make a 10 mM stock solution in 5 ml of DMSO given that the molecular weight of the compound is 350.26 g/mol?
  • Enter 350.26 in the Molecular Weight (MW) box
  • Enter 10 in the Concentration box and choose the correct unit (mM)
  • Enter 5 in the Volume box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 17.513 mg appears in the Mass box. In a similar way, you may calculate the volume and concentration.

Dilution Calculator allows you to calculate how to dilute a stock solution of known concentrations. For example, you may Enter C1, C2 & V2 to calculate V1, as detailed below:

What volume of a given 10 mM stock solution is required to make 25 ml of a 25 μM solution?
Using the equation C1V1 = C2V2, where C1=10 mM, C2=25 μM, V2=25 ml and V1 is the unknown:
  • Enter 10 into the Concentration (Start) box and choose the correct unit (mM)
  • Enter 25 into the Concentration (End) box and select the correct unit (mM)
  • Enter 25 into the Volume (End) box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 62.5 μL (0.1 ml) appears in the Volume (Start) box
g/mol

Molecular Weight Calculator allows you to calculate the molar mass and elemental composition of a compound, as detailed below:

Note: Chemical formula is case sensitive: C12H18N3O4  c12h18n3o4
Instructions to calculate molar mass (molecular weight) of a chemical compound:
  • To calculate molar mass of a chemical compound, please enter the chemical/molecular formula and click the “Calculate’ button.
Definitions of molecular mass, molecular weight, molar mass and molar weight:
  • Molecular mass (or molecular weight) is the mass of one molecule of a substance and is expressed in the unified atomic mass units (u). (1 u is equal to 1/12 the mass of one atom of carbon-12)
  • Molar mass (molar weight) is the mass of one mole of a substance and is expressed in g/mol.
/

Reconstitution Calculator allows you to calculate the volume of solvent required to reconstitute your vial.

  • Enter the mass of the reagent and the desired reconstitution concentration as well as the correct units
  • Click the “Calculate” button
  • The answer appears in the Volume (to add to vial) box
In vivo Formulation Calculator (Clear solution)
Step 1: Enter information below (Recommended: An additional animal to make allowance for loss during the experiment)
Step 2: Enter in vivo formulation (This is only a calculator, not the exact formulation for a specific product. Please contact us first if there is no in vivo formulation in the solubility section.)
+
+
+

Calculation results

Working concentration mg/mL;

Method for preparing DMSO stock solution mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.

Method for preparing in vivo formulation:Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O,mix and clarify.

(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
             (2) Be sure to add the solvent(s) in order.

Contact Us