| Size | Price | Stock | Qty |
|---|---|---|---|
| 1mg |
|
||
| 5mg |
|
||
| Other Sizes |
| Targets |
This peptide targets natriuretic peptide receptors, specifically the guanylyl cyclase receptors natriuretic peptide receptor-A (NPR-A) and receptor-B (NPR-B) [7L22-L23]. By binding to these receptors, it activates an intracellular signaling cascade that produces the second messenger cyclic guanosine monophosphate (cGMP). Activation of this pathway leads to vasodilation, natriuresis (sodium excretion), diuresis (increased urine output), and inhibition of the renin-angiotensin-aldosterone system (RAAS) [7L14-L15].
|
|---|---|
| ln Vitro |
B-type natriuretic peptide (BNP) lowers blood pressure and ventricular fibrosis to counteract cardiac stress. An amino-truncated version of the 45-residue native rat form of BNP is known as rat BNP BNP(1-32) (rBNP(1-32)) [1]. The brain contains three natriuretic peptides that help regulate bodily fluid homeostasis: atrial natriuretic peptide (ANP), brain natriuretic peptide (BNP), and C-type natriuretic peptide (CNP). These peptides are concentrated in the anterior belly of the third ventricle area. In the mammalian brain, ANP(1-28), BNP(1-32), and CNP(1-32) control salt and water balance through their respective receptors, NPR-A and NPR-B [2].
In vitro, rat BNP (1-32) acts as a cardiac hormone that counteracts stress by reducing blood pressure and ventricular fibrosis [20L16-L17]. In cultured vascular smooth muscle cells or renal tubular cells, treatment with BNP leads to an increase in intracellular cGMP levels, which can be measured by ELISA. It also has potent vasodilatory activity in isolated blood vessel preparations, where it relaxes pre-constricted arteries in a concentration-dependent manner. |
| ln Vivo |
to evaluate the effects of cyclic GMP, natriuretic agents, and antihypertensive drugs on various brain natriuretic peptides (BNP) and atrial natriuretic peptides (ANP). Rat BNP (1-32) 3 nmol/kg iv significantly increased the natriuretic and circulatory GMP responses in awake SHR compared to rat ANP 99-126 and pig BNP-26. It also increased the SQ 28,603 by 100 μmol/kg iv. When SHR was administered a vehicle or SQ 28,603, human BNP-32 was inactive. On the other hand, 3 nmol/kg iv rat BNP (1 -32) lowers mean arterial pressure without compromising renal function, while stimulation of the kidneys of conscious monkeys with 1 nmol/kg iv human BNP (1-32) produced depressed reactions greater than or equal to those elicited by human ANP 99-126 [3].
In vivo, rat BNP (1-32) has been shown to have potent natriuretic and depressor (blood pressure-lowering) effects. In a study in conscious spontaneously hypertensive rats (SHR), intravenous administration of 3 nmol/kg rat BNP (1-32) induced a significant increase in sodium excretion (natriuresis) and a decrease in mean arterial pressure [20L31-L34]. Interestingly, human BNP (1-32) was inactive in the SHR, highlighting the species specificity of natriuretic peptides. |
| Enzyme Assay |
The binding of rat BNP (1-32) to its receptors (NPR-A and NPR-B) is typically assessed using radioligand binding assays on membrane preparations from cells overexpressing these receptors. Briefly, membranes are incubated with a fixed concentration of a radiolabeled natriuretic peptide (e.g., [¹2⁵I]-ANP) and increasing concentrations of unlabeled rat BNP (1-32) as a competitor. After incubation, the reaction mixture is filtered to separate bound from free radioligand, and the radioactivity on the filter is counted. The IC₅0 is calculated from the competition curve.
|
| Cell Assay |
Functional assays for rat BNP (1-32) are performed using cells expressing natriuretic peptide receptors, such as cultured rat vascular smooth muscle cells (VSMCs) or 293T cells transfected with NPR-A or NPR-B. Cells are treated with various concentrations of the peptide for 10-15 minutes. The primary endpoint is the production of intracellular cGMP, which can be quantified using a competitive ELISA kit. The half-maximal effective concentration (EC₅0) for cGMP accumulation is a measure of the peptide's potency.
|
| Animal Protocol |
In vivo rat studies are used to characterize the natriuretic and depressor activity of the peptide. For this procedure, a rat (e.g., a Sprague-Dawley or spontaneously hypertensive rat) is anesthetized, and catheters are placed in the femoral artery (for blood pressure monitoring) and bladder (for urine collection). A baseline period is established. The peptide is then administered as a bolus intravenous injection (e.g., 1-10 nmol/kg). Urine volume and sodium excretion are measured over time, and mean arterial pressure (MAP) is continuously recorded. The natriuretic and depressor responses are calculated compared to a vehicle control.
|
| ADME/Pharmacokinetics |
Pharmacokinetic (PK) data for rat BNP (1-32) is characteristic of a native peptide hormone. It has a very short half-life in the circulation (typically measured in minutes) due to rapid degradation by neutral endopeptidases (NEP) and clearance by the natriuretic peptide clearance receptor (NPR-C). Because of this short half-life, continuous infusion is often used in research settings to maintain stable plasma levels.
|
| Toxicity/Toxicokinetics |
Comprehensive toxicological data for rat BNP (1-32) are not detailed in standard product literature, as it is a naturally occurring peptide used for research. The parent, full-length BNP is an endogenous hormone and is generally well-tolerated at physiological concentrations. At research-use concentrations, no specific toxicities are reported. Standard peptide handling safety precautions, including the use of PPE, should be followed.
|
| References |
|
| Additional Infomation |
Brain Natriuretic Peptide (1-32), rat acetate (rBNP (1-32)) is an amino-truncated 32-amino acid form of the 45-residue natural rat BNP, with the sequence NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (disulfide bridge: Cys10-Cys26) [20L12-L13]. It has a molecular formula and weight as listed (approx. MW: 3512.99) [20L3-L4]. The peptide is stored at -20degC and shipped on blue ice [20L4-L7].
|
| Molecular Formula |
C148H243N47O46S3
|
|---|---|
| Molecular Weight |
3512.99
|
| Related CAS # |
Brain Natriuretic Peptide (1-32), rat;133448-20-1
|
| Appearance |
Solid powder
|
| HS Tariff Code |
2934.99.9001
|
| Storage |
Powder -20°C 3 years 4°C 2 years In solvent -80°C 6 months -20°C 1 month Note: Please store this product in a sealed and protected environment, avoid exposure to moisture. |
| Shipping Condition |
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
|
| Solubility (In Vitro) |
May dissolve in DMSO (in most cases), if not, try other solvents such as H2O, Ethanol, or DMF with a minute amount of products to avoid loss of samples
|
|---|---|
| Solubility (In Vivo) |
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.
Injection Formulations
Injection Formulation 1: DMSO : Tween 80： Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution → 50 μL Tween 80 → 850 μL Saline)(e.g. IP/IV/IM/SC) *Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution. Injection Formulation 2: DMSO : PEG300 ：Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO → 400 μLPEG300 → 50 μL Tween 80 → 450 μL Saline) Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO → 900 μL Corn oil) Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals). View More
Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO → 900 μL (20% SBE-β-CD in saline)] Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium) Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals). View More
Oral Formulation 3: Dissolved in PEG400 (Please use freshly prepared in vivo formulations for optimal results.) |
| Preparing Stock Solutions | 1 mg | 5 mg | 10 mg | |
| 1 mM | 0.2847 mL | 1.4233 mL | 2.8466 mL | |
| 5 mM | 0.0569 mL | 0.2847 mL | 0.5693 mL | |
| 10 mM | 0.0285 mL | 0.1423 mL | 0.2847 mL |
*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.
Calculation results
Working concentration： mg/mL；
Method for preparing DMSO stock solution： mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.
Method for preparing in vivo formulation:：Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O，mix and clarify.
(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
(2) Be sure to add the solvent(s) in order.
Products are for research use only; We do not sell to patients
Copyright 2020 InvivoChem LLC | All Rights Reserved
