yingweiwo

human GIP(3-30), amide

Cat No.:V85951 Purity: ≥98%
human GIP(3-30), amide
human GIP(3-30), amide Chemical Structure CAS No.: 1884226-05-4
Product category: Insulin Receptor
This product is for research use only, not for human use. We do not sell to patients.
Size Price Stock Qty
1mg
5mg
10mg
25mg
Other Sizes
Official Supplier of:
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text

 

  • Business Relationship with 5000+ Clients Globally
  • Major Universities, Research Institutions, Biotech & Pharma
  • Citations by Top Journals: Nature, Cell, Science, etc.
Top Publications Citing lnvivochem Products
Purity & Quality Control Documentation

Purity: =95.1%

Product Description
Human GIP(3-30), amide is a high affinity antagonist of the human GIP receptor in vitro.
human GIP(3-30), amide (CAS#: 1884226-05-4) is a high-affinity antagonist of the human gastric inhibitory polypeptide (GIP) receptor, acting as a natural metabolite of DPP-4-cleaved GIP(1-30)NH2. GIP is an incretin hormone secreted by K-cells in the intestine in response to nutrient ingestion. GIP plays a critical role in glucose homeostasis by stimulating insulin secretion from pancreatic β-cells in a glucose-dependent manner. GIP(3-30)NH2 is a naturally occurring metabolite of GIP generated by DPP-4 cleavage of GIP(1-30)NH2, and it acts as a competitive antagonist of the GIP receptor. Human GIP(3-30), amide is the synthetic, amidated form of this metabolite, which acts as a potent competitive antagonist of the GIP receptor. By blocking GIP receptor signaling, this peptide provides a valuable tool for studying the physiological and pathophysiological roles of GIP in metabolism. Molecular formula: C150H226N38O44S, molecular weight: 3297.69. Soluble in DMSO (≥100 mg/mL). The compound is intended for research use only.
Biological Activity I Assay Protocols (From Reference)
Targets
Human GIP receptor (hGIPR). Human GIP(3-30), amide acts as a high-affinity antagonist of the human GIP receptor, blocking GIP-induced signaling. The GIP receptor is a G protein-coupled receptor (GPCR) expressed in pancreatic β-cells, adipose tissue, bone, and the central nervous system. Upon activation by GIP(1-42), the receptor couples to Gs proteins, leading to increased cAMP levels and activation of PKA and Epac. By competitively binding to the GIP receptor, human GIP(3-30), amide blocks GIP-mediated signaling, inhibiting GIP-stimulated insulin secretion and other GIP-dependent effects.
ln Vitro
GIP(3-30)NH2 is a potent competitive antagonist of the GIP receptor and effectively inhibits GIP-mediated insulin, glucagon, and somatostatin release. In vitro, human GIP(3-30), amide acts as a high-affinity antagonist of the human GIP receptor. It inhibits GIP-stimulated insulin secretion from pancreatic β-cells and cAMP production in GIP receptor-expressing cells. The peptide also inhibits GIP-induced β-arrestin recruitment. By blocking GIP receptor signaling, the peptide inhibits GIP-mediated effects on adipocytes, including lipogenesis and fat storage. Detailed IC50 or Ki values are not provided in the available literature, but the compound is described as a high-affinity antagonist.
ln Vivo
Human GIP(3-30), amide has potential anti-obesity and anti-diabetic effects by blocking GIP receptor signaling. GIP plays a role in glucose homeostasis, insulin secretion, and energy balance. In obesity, GIP levels are elevated, and GIP receptor signaling promotes fat storage and adiposity. By blocking GIP receptor signaling, GIP(3-30)NH2 may reduce fat accumulation and improve glucose tolerance. In animal models of obesity and diabetes, GIP receptor antagonists have been shown to improve glucose tolerance, reduce body weight, and ameliorate insulin resistance. The peptide is used in research to investigate the role of GIP in metabolic disorders such as diabetes and obesity.
Enzyme Assay
Receptor binding assays are performed using radiolabeled GIP (e.g., 125I-GIP) incubated with membranes expressing the human GIP receptor in the presence of varying concentrations of human GIP(3-30), amide. Bound radioactivity is separated from free radioligand by filtration or centrifugation, and the inhibition of specific binding is calculated. IC50 or Ki values are determined by fitting competition binding data to a sigmoidal dose-response curve.
Cell Assay
cAMP accumulation assays are performed using cells expressing the human GIP receptor treated with human GIP(3-30), amide followed by GIP(1-42) stimulation. Intracellular cAMP levels are measured via ELISA or FRET-based methods. The ability of the antagonist to inhibit GIP-stimulated cAMP production demonstrates its functional antagonism. β-arrestin recruitment assays can also be performed to assess the effects of the antagonist on GIP-induced β-arrestin signaling.
Animal Protocol
Animal models of obesity and diabetes are administered human GIP(3-30), amide via subcutaneous or intraperitoneal routes. Glucose tolerance tests (OGTT) are performed to assess the effects of the antagonist on glucose handling. Insulin levels are measured to evaluate the effects on insulin secretion. Body weight and food intake are monitored to assess the effects on energy balance. The peptide is used to investigate the role of GIP in metabolic disorders.
ADME/Pharmacokinetics
Human GIP(3-30), amide is a naturally occurring peptide metabolite with a short half-life due to rapid renal clearance and proteolytic degradation. GIP(3-30)NH2 is a naturally occurring metabolite of GIP, and its half-life is limited by DPP-4 cleavage and renal clearance. Pharmacokinetic parameters are evaluated in rodents. The peptide is typically administered via parenteral routes for in vivo studies. Detailed PK data specific to human GIP(3-30), amide are not extensively reported in the available literature.
Toxicity/Toxicokinetics
Peptide-based GIP receptor antagonists are generally well-tolerated at therapeutic doses. Potential toxicities may include gastrointestinal effects and hypoglycemia due to GIP signaling blockade. Standard toxicology studies are required for therapeutic development. As a research compound, detailed toxicology data are not publicly available.
References

[1].GIP(3-30)NH2 is a potent competitive antagonist of the GIP receptor and effectively inhibits GIP-mediated insulin, glucagon, and somatostatin release. Biochem Pharmacol. 2017;131:78-88.

Additional Infomation
Human GIP(3-30), amide is a research-grade peptide antagonist for metabolic research. Molecular formula: C150H226N38O44S, molecular weight: 3297.69. Soluble in DMSO (≥100 mg/mL). It is a synthetic peptide corresponding to amino acids 3-30 of human GIP with C-terminal amidation. It is a potent competitive antagonist of the GIP receptor and effectively inhibits GIP-mediated insulin, glucagon, and somatostatin release. CAS: 1884226-05-4. Synonyms: GIP(3-30)NH2. For research use only, not for human therapeutic use.
These protocols are for reference only. InvivoChem does not independently validate these methods.
Physicochemical Properties
Molecular Formula
C150H226N38O44S
Molecular Weight
3297.69
CAS #
1884226-05-4
Sequence
Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2
SequenceShortening
EGTFISDYSIAMDKIHQQDFVNWLLAQK-NH2
Appearance
White to off-white solid powder
HS Tariff Code
2934.99.9001
Storage

Powder      -20°C    3 years

                     4°C     2 years

In solvent   -80°C    6 months

                  -20°C    1 month

Shipping Condition
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
Solubility Data
Solubility (In Vitro)
Typically soluble in DMSO (e.g. 10 mM)
Solubility (In Vivo)
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.

Injection Formulations
(e.g. IP/IV/IM/SC)
Injection Formulation 1: DMSO : Tween 80: Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution 50 μL Tween 80 850 μL Saline)
*Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution.
Injection Formulation 2: DMSO : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO 400 μLPEG300 50 μL Tween 80 450 μL Saline)
Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO 900 μL Corn oil)
Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals).
View More

Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO 900 μL (20% SBE-β-CD in saline)]
*Preparation of 20% SBE-β-CD in Saline (4°C,1 week): Dissolve 2 g SBE-β-CD in 10 mL saline to obtain a clear solution.
Injection Formulation 5: 2-Hydroxypropyl-β-cyclodextrin : Saline = 50 : 50 (i.e. 500 μL 2-Hydroxypropyl-β-cyclodextrin 500 μL Saline)
Injection Formulation 6: DMSO : PEG300 : castor oil : Saline = 5 : 10 : 20 : 65 (i.e. 50 μL DMSO 100 μLPEG300 200 μL castor oil 650 μL Saline)
Injection Formulation 7: Ethanol : Cremophor : Saline = 10: 10 : 80 (i.e. 100 μL Ethanol 100 μL Cremophor 800 μL Saline)
Injection Formulation 8: Dissolve in Cremophor/Ethanol (50 : 50), then diluted by Saline
Injection Formulation 9: EtOH : Corn oil = 10 : 90 (i.e. 100 μL EtOH 900 μL Corn oil)
Injection Formulation 10: EtOH : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL EtOH 400 μLPEG300 50 μL Tween 80 450 μL Saline)


Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium)
Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose
Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals).
View More

Oral Formulation 3: Dissolved in PEG400
Oral Formulation 4: Suspend in 0.2% Carboxymethyl cellulose
Oral Formulation 5: Dissolve in 0.25% Tween 80 and 0.5% Carboxymethyl cellulose
Oral Formulation 6: Mixing with food powders


Note: Please be aware that the above formulations are for reference only. InvivoChem strongly recommends customers to read literature methods/protocols carefully before determining which formulation you should use for in vivo studies, as different compounds have different solubility properties and have to be formulated differently.

 (Please use freshly prepared in vivo formulations for optimal results.)
Preparing Stock Solutions 1 mg 5 mg 10 mg
1 mM 0.3032 mL 1.5162 mL 3.0324 mL
5 mM 0.0606 mL 0.3032 mL 0.6065 mL
10 mM 0.0303 mL 0.1516 mL 0.3032 mL

*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.

Calculator

Molarity Calculator allows you to calculate the mass, volume, and/or concentration required for a solution, as detailed below:

  • Calculate the Mass of a compound required to prepare a solution of known volume and concentration
  • Calculate the Volume of solution required to dissolve a compound of known mass to a desired concentration
  • Calculate the Concentration of a solution resulting from a known mass of compound in a specific volume
An example of molarity calculation using the molarity calculator is shown below:
What is the mass of compound required to make a 10 mM stock solution in 5 ml of DMSO given that the molecular weight of the compound is 350.26 g/mol?
  • Enter 350.26 in the Molecular Weight (MW) box
  • Enter 10 in the Concentration box and choose the correct unit (mM)
  • Enter 5 in the Volume box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 17.513 mg appears in the Mass box. In a similar way, you may calculate the volume and concentration.

Dilution Calculator allows you to calculate how to dilute a stock solution of known concentrations. For example, you may Enter C1, C2 & V2 to calculate V1, as detailed below:

What volume of a given 10 mM stock solution is required to make 25 ml of a 25 μM solution?
Using the equation C1V1 = C2V2, where C1=10 mM, C2=25 μM, V2=25 ml and V1 is the unknown:
  • Enter 10 into the Concentration (Start) box and choose the correct unit (mM)
  • Enter 25 into the Concentration (End) box and select the correct unit (mM)
  • Enter 25 into the Volume (End) box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 62.5 μL (0.1 ml) appears in the Volume (Start) box
g/mol

Molecular Weight Calculator allows you to calculate the molar mass and elemental composition of a compound, as detailed below:

Note: Chemical formula is case sensitive: C12H18N3O4  c12h18n3o4
Instructions to calculate molar mass (molecular weight) of a chemical compound:
  • To calculate molar mass of a chemical compound, please enter the chemical/molecular formula and click the “Calculate’ button.
Definitions of molecular mass, molecular weight, molar mass and molar weight:
  • Molecular mass (or molecular weight) is the mass of one molecule of a substance and is expressed in the unified atomic mass units (u). (1 u is equal to 1/12 the mass of one atom of carbon-12)
  • Molar mass (molar weight) is the mass of one mole of a substance and is expressed in g/mol.
/

Reconstitution Calculator allows you to calculate the volume of solvent required to reconstitute your vial.

  • Enter the mass of the reagent and the desired reconstitution concentration as well as the correct units
  • Click the “Calculate” button
  • The answer appears in the Volume (to add to vial) box
In vivo Formulation Calculator (Clear solution)
Step 1: Enter information below (Recommended: An additional animal to make allowance for loss during the experiment)
Step 2: Enter in vivo formulation (This is only a calculator, not the exact formulation for a specific product. Please contact us first if there is no in vivo formulation in the solubility section.)
+
+
+

Calculation results

Working concentration mg/mL;

Method for preparing DMSO stock solution mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.

Method for preparing in vivo formulation:Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O,mix and clarify.

(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
             (2) Be sure to add the solvent(s) in order.

Contact Us