yingweiwo

{Val1}-Exendin-3/4

Cat No.:V77336 Purity: ≥98%
{Val1}-Exendin-3/4 is residues 1-28 of the N-terminus of the Exendin-4 polypeptide.
{Val1}-Exendin-3/4
{Val1}-Exendin-3/4 Chemical Structure Product category: GCGR
This product is for research use only, not for human use. We do not sell to patients.
Size Price Stock Qty
1mg
5mg
Other Sizes
Official Supplier of:
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text

 

  • Business Relationship with 5000+ Clients Globally
  • Major Universities, Research Institutions, Biotech & Pharma
  • Citations by Top Journals: Nature, Cell, Science, etc.
Top Publications Citing lnvivochem Products
Product Description
{Val1}-Exendin-3/4 is residues 1-28 of the N-terminus of the Exendin-4 polypeptide.
{Val1}-Exendin-3/4 is a synthetic peptide and a derivative of Exendin-4. It comprises the first N-terminal 1-28 residues of the Exendin-4 peptide, with a Valine substitution at position 1. It serves as a research tool to study GLP-1 receptor agonists and their effects on metabolic disorders. MW: 3241.70; Sequence: VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS.
Biological Activity I Assay Protocols (From Reference)
Targets
Glucagon-like peptide-1 receptor (GLP-1R). The parent compound, Exendin-4, is a pure GLP-1 receptor agonist (incretin mimetic). {Val1}-Exendin-3/4 is a fragment of Exendin-4 and retains activity at the GLP-1 receptor. This receptor is the primary target for treating type 2 diabetes and obesity, as its activation enhances insulin secretion (glucose-dependent) and promotes satiety.
ln Vitro
Exendin-4 is a pure agonist of the GLP-1 receptor. Structurally generated from exendin-4, exendin-4 peptide derivatives may have a connection to dual GLP-1/glucagon receptor agonists. Their usage in medicine, for instance, includes reducing excessive food consumption and treating metabolic syndrome illnesses like diabetes and obesity. In order to lower the risk of hypoglycemia, these dual GLP-1/glucagon receptor agonists exhibit decreased action on the GIP receptor[1].
In vitro, Exendin-4 and its derivatives, including {Val1}-Exendin-3/4, act as GLP-1 receptor agonists. Structurally derived from exendin-4, exendin-4 peptide derivatives may have a connection to dual GLP-1/glucagon receptor agonists. These dual agonists show reduced activity on the GIP receptor to reduce the risk of hypoglycemia. The peptide is used to study incretin signaling in beta-cell lines..
ln Vivo
In vivo, Exendin-4 peptide derivatives, like {Val1}-Exendin-3/4, are used to treat metabolic syndrome disorders, including diabetes and obesity, as well as for reduction of excess food intake. They are being studied as dual GLP-1/glucagon receptor agonists to maximize weight loss and glycemic control while minimizing gastrointestinal side effects.
Enzyme Assay
A non-cell binding assay, such as surface plasmon resonance (SPR), is performed to confirm GLP-1R binding. Recombinant human GLP-1R protein is immobilized on a sensor chip. Varying concentrations of {Val1}-Exendin-3/4 are flowed over the chip to measure the binding affinity (Kd). Alternatively, a radioactive ligand competition assay using [125I]-GLP-1 is used.
Cell Assay
A functional cAMP accumulation assay is performed using HEK293 cells stably expressing the human GLP-1 receptor. Cells are seeded in 96-well plates and treated with varying concentrations of the peptide (0.001-1000 nM) in the presence of 1 mM IBMX. After 30 minutes, cAMP levels are measured by HTRF or ELISA. The EC50 for cAMP stimulation is calculated from the dose-response curve.
Animal Protocol
In vivo efficacy for metabolic indications is studied in rodent models. For an acute glucose-lowering test, male C57BL/6J mice are fasted overnight. The peptide is administered subcutaneously (SC) at doses of 10-100 ug/kg. An oral glucose tolerance test (OGTT) is performed 30 minutes later, and blood glucose is measured at intervals. Chronic administration studies in diet-induced obesity (DIO) mice monitor body weight and food intake.
ADME/Pharmacokinetics
The peptide has a molecular weight of 3241.70. It is soluble in water (H2O) and DMSO. For in vivo administration, the peptide is formulated in sterile saline or PBS (pH 7.4). Peptides generally have short plasma half-lives (30-60 minutes) due to rapid proteolytic degradation and renal clearance. Stability is improved by the acetate salt form. Storage: -80degC.
Toxicity/Toxicokinetics
The toxicity of {Val1}-Exendin-3/4 is not well-documented. GLP-1 agonists as a class are generally well-tolerated. Common side effects of GLP-1 agonists include gastrointestinal disturbances (nausea, vomiting, diarrhea) and potential risk of pancreatitis. The peptide is for research use only and not for human therapeutic use.
References
[1]. US20150315260 A1
Additional Infomation
{Val1}-Exendin-3/4 is a research-grade peptide used as a GLP-1 receptor agonist. It is not a drug and has no FDA approval for human therapy. It is used to study incretin mimetics and dual GLP-1/glucagon receptor agonists for treating metabolic syndrome illnesses like diabetes and obesity. This product is for research use only (RUO).
These protocols are for reference only. InvivoChem does not independently validate these methods.
Physicochemical Properties
Molecular Weight
3241.70
Appearance
Typically exists as solid at room temperature
HS Tariff Code
2934.99.9001
Storage

Powder      -20°C    3 years

                     4°C     2 years

In solvent   -80°C    6 months

                  -20°C    1 month

Note: Please store this product in a sealed and protected environment (e.g. under nitrogen), avoid exposure to moisture and light.
Shipping Condition
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
Solubility Data
Solubility (In Vitro)
May dissolve in DMSO (in most cases), if not, try other solvents such as H2O, Ethanol, or DMF with a minute amount of products to avoid loss of samples
Solubility (In Vivo)
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.

Injection Formulations
(e.g. IP/IV/IM/SC)
Injection Formulation 1: DMSO : Tween 80: Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution 50 μL Tween 80 850 μL Saline)
*Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution.
Injection Formulation 2: DMSO : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO 400 μLPEG300 50 μL Tween 80 450 μL Saline)
Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO 900 μL Corn oil)
Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals).
View More

Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO 900 μL (20% SBE-β-CD in saline)]
*Preparation of 20% SBE-β-CD in Saline (4°C,1 week): Dissolve 2 g SBE-β-CD in 10 mL saline to obtain a clear solution.
Injection Formulation 5: 2-Hydroxypropyl-β-cyclodextrin : Saline = 50 : 50 (i.e. 500 μL 2-Hydroxypropyl-β-cyclodextrin 500 μL Saline)
Injection Formulation 6: DMSO : PEG300 : castor oil : Saline = 5 : 10 : 20 : 65 (i.e. 50 μL DMSO 100 μLPEG300 200 μL castor oil 650 μL Saline)
Injection Formulation 7: Ethanol : Cremophor : Saline = 10: 10 : 80 (i.e. 100 μL Ethanol 100 μL Cremophor 800 μL Saline)
Injection Formulation 8: Dissolve in Cremophor/Ethanol (50 : 50), then diluted by Saline
Injection Formulation 9: EtOH : Corn oil = 10 : 90 (i.e. 100 μL EtOH 900 μL Corn oil)
Injection Formulation 10: EtOH : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL EtOH 400 μLPEG300 50 μL Tween 80 450 μL Saline)


Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium)
Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose
Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals).
View More

Oral Formulation 3: Dissolved in PEG400
Oral Formulation 4: Suspend in 0.2% Carboxymethyl cellulose
Oral Formulation 5: Dissolve in 0.25% Tween 80 and 0.5% Carboxymethyl cellulose
Oral Formulation 6: Mixing with food powders


Note: Please be aware that the above formulations are for reference only. InvivoChem strongly recommends customers to read literature methods/protocols carefully before determining which formulation you should use for in vivo studies, as different compounds have different solubility properties and have to be formulated differently.

 (Please use freshly prepared in vivo formulations for optimal results.)
Preparing Stock Solutions 1 mg 5 mg 10 mg
1 mM 0.3085 mL 1.5424 mL 3.0848 mL
5 mM 0.0617 mL 0.3085 mL 0.6170 mL
10 mM 0.0308 mL 0.1542 mL 0.3085 mL

*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.

Calculator

Molarity Calculator allows you to calculate the mass, volume, and/or concentration required for a solution, as detailed below:

  • Calculate the Mass of a compound required to prepare a solution of known volume and concentration
  • Calculate the Volume of solution required to dissolve a compound of known mass to a desired concentration
  • Calculate the Concentration of a solution resulting from a known mass of compound in a specific volume
An example of molarity calculation using the molarity calculator is shown below:
What is the mass of compound required to make a 10 mM stock solution in 5 ml of DMSO given that the molecular weight of the compound is 350.26 g/mol?
  • Enter 350.26 in the Molecular Weight (MW) box
  • Enter 10 in the Concentration box and choose the correct unit (mM)
  • Enter 5 in the Volume box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 17.513 mg appears in the Mass box. In a similar way, you may calculate the volume and concentration.

Dilution Calculator allows you to calculate how to dilute a stock solution of known concentrations. For example, you may Enter C1, C2 & V2 to calculate V1, as detailed below:

What volume of a given 10 mM stock solution is required to make 25 ml of a 25 μM solution?
Using the equation C1V1 = C2V2, where C1=10 mM, C2=25 μM, V2=25 ml and V1 is the unknown:
  • Enter 10 into the Concentration (Start) box and choose the correct unit (mM)
  • Enter 25 into the Concentration (End) box and select the correct unit (mM)
  • Enter 25 into the Volume (End) box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 62.5 μL (0.1 ml) appears in the Volume (Start) box
g/mol

Molecular Weight Calculator allows you to calculate the molar mass and elemental composition of a compound, as detailed below:

Note: Chemical formula is case sensitive: C12H18N3O4  c12h18n3o4
Instructions to calculate molar mass (molecular weight) of a chemical compound:
  • To calculate molar mass of a chemical compound, please enter the chemical/molecular formula and click the “Calculate’ button.
Definitions of molecular mass, molecular weight, molar mass and molar weight:
  • Molecular mass (or molecular weight) is the mass of one molecule of a substance and is expressed in the unified atomic mass units (u). (1 u is equal to 1/12 the mass of one atom of carbon-12)
  • Molar mass (molar weight) is the mass of one mole of a substance and is expressed in g/mol.
/

Reconstitution Calculator allows you to calculate the volume of solvent required to reconstitute your vial.

  • Enter the mass of the reagent and the desired reconstitution concentration as well as the correct units
  • Click the “Calculate” button
  • The answer appears in the Volume (to add to vial) box
In vivo Formulation Calculator (Clear solution)
Step 1: Enter information below (Recommended: An additional animal to make allowance for loss during the experiment)
Step 2: Enter in vivo formulation (This is only a calculator, not the exact formulation for a specific product. Please contact us first if there is no in vivo formulation in the solubility section.)
+
+
+

Calculation results

Working concentration mg/mL;

Method for preparing DMSO stock solution mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.

Method for preparing in vivo formulation:Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O,mix and clarify.

(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
             (2) Be sure to add the solvent(s) in order.

Contact Us