yingweiwo

CRF, bovine TFA (Corticotropin Releasing Factor bovine TFA)

Cat No.:V77136 Purity: ≥98%
CRF, bovine (TFA) is a potent CRF receptor agonist that can replace [125I-Tyr]ovine CRF with a Ki of 3.52 nM.
CRF, bovine TFA (Corticotropin Releasing Factor bovine TFA)
CRF, bovine TFA (Corticotropin Releasing Factor bovine TFA) Chemical Structure Product category: CRFR
This product is for research use only, not for human use. We do not sell to patients.
Size Price Stock Qty
1mg
Other Sizes

Other Forms of CRF, bovine TFA (Corticotropin Releasing Factor bovine TFA):

  • CRF, bovine
Official Supplier of:
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Top Publications Citing lnvivochem Products
Product Description
CRF, bovine (TFA) is a potent CRF receptor agonist that can replace [125I-Tyr]ovine CRF with a Ki of 3.52 nM.
CRF, bovine TFA (Corticotropin Releasing Factor, bovine, trifluoroacetate salt) is a synthetic 41-amino acid peptide corresponding to the naturally occurring corticotropin-releasing hormone in bovine species. It is a potent CRF receptor agonist used for receptor studies and HPA axis research.
Biological Activity I Assay Protocols (From Reference)
Targets
Ki: 3.52 nM (CRF receptor)[1].
CRF, bovine TFA is a potent and selective agonist of the CRF receptor (CRFR). It displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM. It shows pEC50 values of 11.16, 8.53, and 8.70 for human CRF1, human CRF2, and rat CRF2alpha, respectively. It binds with highest affinity to human CRF1.
ln Vitro
CRF, bovine is a strong agonist of the CRF receptor and has a Ki of 3.52 nM, which allows it to displace [125I-Tyr]ovine CRF[1]. The pEC50 values for rat CRF2α, human CRF1, and human CRF2 are 8.53, 8.70, and 11.16 in CRF[2]. Stress-induced release of CRF from the hypothalamic-pituitary-adrenal (HPA) axis results in the synthesis of glucocorticoids, which suppress immunological responses. CRF also contributes to inflammation. Brain microvessel endothelial cells (BMEC) are impacted by CRF in terms of their structure or function. CRF at 100 nM dramatically raises cAMP in BMEC[3].
In vitro, CRF, bovine TFA is a strong agonist of the CRF receptor. It is used to study CRF receptor subtype specificity, binding affinity, and signal transduction pathways. It activates adenylate cyclase and increases cAMP accumulation in cells expressing CRF1 or CRF2 receptors in a concentration-dependent manner.
ln Vivo
CRF is released from the hypothalamic-pituitary-adrenal (HPA) axis in response to stress and leads to the production of glucocorticoids, which down-regulate immune responses. In animal models, CRF administration induces anxiety-like behaviors and activates the HPA axis, increasing plasma ACTH and corticosterone levels.
Enzyme Assay
For in vitro binding assays, CRF receptor affinity is determined using radioligand displacement. Membranes from CHO cells stably expressing human CRF1 or CRF2 are incubated with 0.05 nM [125I-Tyr]ovine CRF and varying concentrations of unlabeled CRF, bovine TFA (0-1000 nM) in assay buffer (50 mM Tris-HCl, 2 mM EGTA, 5 mM MgCl2, 0.1% BSA). After 90 minutes at 25degC, bound radioactivity is measured by filtration.
Cell Assay
For cell-based assays, cells expressing CRF receptors (e.g., Y-79 retinoblastoma cells or transfected HEK293 cells) are seeded in 96-well plates. Cells are treated with CRF, bovine TFA (0-1000 nM) for 15-30 minutes at 37degC. cAMP accumulation is measured using a homogeneous time-resolved fluorescence (HTRF) or a chemiluminescence-based immunoassay. EC50 values are calculated from dose-response curves.
Animal Protocol
For animal studies of stress response and anxiety, male C57BL/6J mice (6-8 weeks) are anesthetized and implanted with an intracerebroventricular (i.c.v.) cannula. CRF, bovine TFA is dissolved in artificial cerebrospinal fluid (aCSF). On test day, mice receive an i.c.v. injection of CRF (0.1-1 microg). Behavior is assessed 30 minutes post-injection using the elevated plus maze (EPM) and open-field test. Plasma is collected for ACTH and corticosterone measurement.
ADME/Pharmacokinetics
CRF, bovine TFA (bovine CRF) has a molecular weight of approximately 4697.34 Da. The TFA salt form enhances water solubility (1 mg/mL in water or saline). As a peptide, it is susceptible to proteolytic degradation; it should be stored lyophilized at -20degC and reconstituted immediately before use. CRF has a short half-life in vivo (minutes).
Toxicity/Toxicokinetics
CRF, bovine TFA is a research-grade peptide (purity typically >98% by HPLC) intended for research use only. It is non-toxic at typical research doses. Standard precautions for handling peptides (avoid inhalation, skin contact) should be followed. High doses may cause prolonged HPA axis activation. It is not for human therapeutic use.
References

[1]. CRF, bovine is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM[1]. CRF shows pEC50s of 11.16, 8.53 and 8.70 for human CRF1, human CRF2 and rat CRF2α[2]. CRF is released from hypothalamic-pituitary-adrenal (HPA) axis induced by stress, and leads to production of glucocorticoids which down regulate immune responses. CRF also has proinflammatory effects. CRF affects brain microvessel endothelial cells (BMEC) structure or function, CRF (100 nM) significantly increases cAMP in BMEC[3].

[2]. Characterisation using microphysiometry of CRF receptor pharmacology. Eur J Pharmacol. 1999 Aug 27;379(2-3):229-35.

[3]. Corticotropin-releasing factor (CRF) can directly affect brain microvessel endothelial cells. Brain Res. 2003 Apr 11;968(2):192-8.

Additional Infomation
CRF, bovine TFA (CAS: 92307-52-3; Sequence: SQEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2) is used as a reference ligand for characterizing CRF receptor subtype specificity, binding affinity, and signal transduction. It is structurally identical to human/rat CRF except for seven amino acid substitutions. It is used in HPA axis, stress, and anxiety research.
These protocols are for reference only. InvivoChem does not independently validate these methods.
Physicochemical Properties
Molecular Formula
C208H341F3N60O65S
Molecular Weight
4811.36
Related CAS #
CRF, bovine;92307-52-3
Appearance
White to off-white solid powder
HS Tariff Code
2934.99.9001
Storage

Powder      -20°C    3 years

                     4°C     2 years

In solvent   -80°C    6 months

                  -20°C    1 month

Note: Please store this product in a sealed and protected environment, avoid exposure to moisture.
Shipping Condition
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
Solubility Data
Solubility (In Vitro)
May dissolve in DMSO (in most cases), if not, try other solvents such as H2O, Ethanol, or DMF with a minute amount of products to avoid loss of samples
Solubility (In Vivo)
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.

Injection Formulations
(e.g. IP/IV/IM/SC)
Injection Formulation 1: DMSO : Tween 80: Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution 50 μL Tween 80 850 μL Saline)
*Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution.
Injection Formulation 2: DMSO : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO 400 μLPEG300 50 μL Tween 80 450 μL Saline)
Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO 900 μL Corn oil)
Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals).
View More

Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO 900 μL (20% SBE-β-CD in saline)]
*Preparation of 20% SBE-β-CD in Saline (4°C,1 week): Dissolve 2 g SBE-β-CD in 10 mL saline to obtain a clear solution.
Injection Formulation 5: 2-Hydroxypropyl-β-cyclodextrin : Saline = 50 : 50 (i.e. 500 μL 2-Hydroxypropyl-β-cyclodextrin 500 μL Saline)
Injection Formulation 6: DMSO : PEG300 : castor oil : Saline = 5 : 10 : 20 : 65 (i.e. 50 μL DMSO 100 μLPEG300 200 μL castor oil 650 μL Saline)
Injection Formulation 7: Ethanol : Cremophor : Saline = 10: 10 : 80 (i.e. 100 μL Ethanol 100 μL Cremophor 800 μL Saline)
Injection Formulation 8: Dissolve in Cremophor/Ethanol (50 : 50), then diluted by Saline
Injection Formulation 9: EtOH : Corn oil = 10 : 90 (i.e. 100 μL EtOH 900 μL Corn oil)
Injection Formulation 10: EtOH : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL EtOH 400 μLPEG300 50 μL Tween 80 450 μL Saline)


Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium)
Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose
Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals).
View More

Oral Formulation 3: Dissolved in PEG400
Oral Formulation 4: Suspend in 0.2% Carboxymethyl cellulose
Oral Formulation 5: Dissolve in 0.25% Tween 80 and 0.5% Carboxymethyl cellulose
Oral Formulation 6: Mixing with food powders


Note: Please be aware that the above formulations are for reference only. InvivoChem strongly recommends customers to read literature methods/protocols carefully before determining which formulation you should use for in vivo studies, as different compounds have different solubility properties and have to be formulated differently.

 (Please use freshly prepared in vivo formulations for optimal results.)
Preparing Stock Solutions 1 mg 5 mg 10 mg
1 mM 0.2078 mL 1.0392 mL 2.0784 mL
5 mM 0.0416 mL 0.2078 mL 0.4157 mL
10 mM 0.0208 mL 0.1039 mL 0.2078 mL

*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.

Calculator

Molarity Calculator allows you to calculate the mass, volume, and/or concentration required for a solution, as detailed below:

  • Calculate the Mass of a compound required to prepare a solution of known volume and concentration
  • Calculate the Volume of solution required to dissolve a compound of known mass to a desired concentration
  • Calculate the Concentration of a solution resulting from a known mass of compound in a specific volume
An example of molarity calculation using the molarity calculator is shown below:
What is the mass of compound required to make a 10 mM stock solution in 5 ml of DMSO given that the molecular weight of the compound is 350.26 g/mol?
  • Enter 350.26 in the Molecular Weight (MW) box
  • Enter 10 in the Concentration box and choose the correct unit (mM)
  • Enter 5 in the Volume box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 17.513 mg appears in the Mass box. In a similar way, you may calculate the volume and concentration.

Dilution Calculator allows you to calculate how to dilute a stock solution of known concentrations. For example, you may Enter C1, C2 & V2 to calculate V1, as detailed below:

What volume of a given 10 mM stock solution is required to make 25 ml of a 25 μM solution?
Using the equation C1V1 = C2V2, where C1=10 mM, C2=25 μM, V2=25 ml and V1 is the unknown:
  • Enter 10 into the Concentration (Start) box and choose the correct unit (mM)
  • Enter 25 into the Concentration (End) box and select the correct unit (mM)
  • Enter 25 into the Volume (End) box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 62.5 μL (0.1 ml) appears in the Volume (Start) box
g/mol

Molecular Weight Calculator allows you to calculate the molar mass and elemental composition of a compound, as detailed below:

Note: Chemical formula is case sensitive: C12H18N3O4  c12h18n3o4
Instructions to calculate molar mass (molecular weight) of a chemical compound:
  • To calculate molar mass of a chemical compound, please enter the chemical/molecular formula and click the “Calculate’ button.
Definitions of molecular mass, molecular weight, molar mass and molar weight:
  • Molecular mass (or molecular weight) is the mass of one molecule of a substance and is expressed in the unified atomic mass units (u). (1 u is equal to 1/12 the mass of one atom of carbon-12)
  • Molar mass (molar weight) is the mass of one mole of a substance and is expressed in g/mol.
/

Reconstitution Calculator allows you to calculate the volume of solvent required to reconstitute your vial.

  • Enter the mass of the reagent and the desired reconstitution concentration as well as the correct units
  • Click the “Calculate” button
  • The answer appears in the Volume (to add to vial) box
In vivo Formulation Calculator (Clear solution)
Step 1: Enter information below (Recommended: An additional animal to make allowance for loss during the experiment)
Step 2: Enter in vivo formulation (This is only a calculator, not the exact formulation for a specific product. Please contact us first if there is no in vivo formulation in the solubility section.)
+
+
+

Calculation results

Working concentration mg/mL;

Method for preparing DMSO stock solution mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.

Method for preparing in vivo formulation:Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O,mix and clarify.

(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
             (2) Be sure to add the solvent(s) in order.

Contact Us