yingweiwo

Super-TDU (1-31) (TFA)

Cat No.:V76465 Purity: ≥98%
Super-TDU (1-31) TFA is the peptide fragment of Super-TDU.
Super-TDU (1-31) (TFA)
Super-TDU (1-31) (TFA) Chemical Structure Product category: YAP
This product is for research use only, not for human use. We do not sell to patients.
Size Price Stock Qty
1mg
Other Sizes

Other Forms of Super-TDU (1-31) (TFA):

  • Super-TDU (1-31)
Official Supplier of:
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Top Publications Citing lnvivochem Products
Product Description
Super-TDU (1-31) TFA is the peptide fragment of Super-TDU. Super-TDU (1-31) TFA is an inhibitor (blocker/antagonist) of the YAP-TEAD complex. Super-TDU TFA showed potent anticancer effect and inhibited tumor growth in gastric cancer mouse models.
Super-TDU (1-31) TFA is a peptide fragment of Super-TDU that acts as an inhibitor of the YAP-TEAD complex. YAP (Yes-associated protein) and TEAD (TEA domain transcription factor) are key transcription factors in the Hippo signaling pathway, which regulates organ size and tumorigenesis. Super-TDU TFA disrupts YAP-TEAD interactions, showing potent anti-tumor activity in gastric cancer mouse models. The TFA salt is used for peptide stability.
Biological Activity I Assay Protocols (From Reference)
Targets
YAP-TEAD complex. Super-TDU (1-31) TFA is an inhibitor of the YAP-TEAD interaction. By binding to YAP, it prevents the association of YAP with the TEAD transcription factor, thereby blocking the transcriptional activity of the Hippo pathway. This inhibition suppresses cell proliferation and induces apoptosis in YAP-dependent cancers.
ln Vitro
Super-TDU(1-31) TFA (50 nM; 24-72 hours) can significantly reduce the increase in cell viability in Huh-7 or LM3 cell proliferation that is produced by ACTN1 [1].
Super-TDU (1-31) TFA (50 nM, 24-72 h) largely compromises ACTN1-induced cell viability increases in liver cancer cell lines, including Huh-7 and LM3 cells. By disrupting YAP-TEAD complex formation, it inhibits the transcription of YAP target genes involved in cell proliferation and survival. The peptide demonstrates selective inhibitory activity against YAP-dependent cancer cell proliferation.
ln Vivo
Super-TDU (1-31) TFA shows potent anti-tumor activity in a gastric cancer mouse model, inhibiting tumor growth. Administration of Super-TDU TFA leads to suppression of tumor progression and reduced tumor volume. The in vivo efficacy supports the therapeutic potential of targeting the YAP-TEAD complex with peptide inhibitors for the treatment of cancers driven by hyperactive Hippo signaling.
Enzyme Assay
YAP-TEAD binding inhibition assay (SPR or ELISA): Recombinant YAP protein is immobilized on a sensor chip or ELISA plate. Increasing concentrations of Super-TDU (1-31) TFA (0-1000 nM) are pre-incubated with TEAD protein. The mixture is injected, and the amount of bound TEAD is detected by specific antibodies. Alternatively, a fluorescence polarization assay using labeled TEAD peptide and purified YAP can be used.
Cell Assay
Cell Viability Assay[2]
Cell Types: Liver cancer cell lines of human, including Huh-7, LM3 cells
Tested Concentrations: 50 nM
Incubation Duration: 24, 48 and 72 h
Experimental Results: Could largely compromise the increased cell viability induced by ACTN1.
Cell viability assay: Human liver cancer cells (Huh-7 or LM3) are seeded in 96-well plates (5,000 cells/well) and treated with Super-TDU (1-31) TFA at concentrations of 0-500 nM for 24-72 h. Cell viability is assessed using CCK-8 or MTT assay. For mechanism studies, cells are treated with 50 nM peptide for 48 h, and YAP target gene expression (CTGF, CYR61, ANKRD1) is measured by qRT-PCR.
Animal Protocol
Gastric cancer xenograft model: Female BALB/c nude mice (6-8 weeks old) are subcutaneously implanted with gastric cancer cells (5×10⁶ cells/mouse). When tumors reach ~100 mm3, mice are randomized into groups (n=6-8). Super-TDU (1-31) TFA is administered via intratumoral injection or intraperitoneally at doses of 5-20 mg/kg, every other day for 2-3 weeks. Tumor volume is measured every 3 days using calipers. TUNEL and Ki-67 staining are performed on tumor sections.
ADME/Pharmacokinetics
Pharmacokinetic data for Super-TDU (1-31) TFA are limited. As a 31-amino acid peptide (MW 3355.5, TFA salt), it has poor oral bioavailability and a short plasma half-life (typically minutes) due to proteolytic degradation. It is administered via intratumoral or intraperitoneal injection for in vivo studies. The powder should be stored at -20degC, sealed and away from light and moisture.
Toxicity/Toxicokinetics
Toxicity data for Super-TDU (1-31) TFA are limited. As a peptide disrupting the YAP-TEAD interaction, it is intended for research use only and not for human therapeutic applications. In mouse xenograft models at effective doses (5-20 mg/kg, every other day), no significant body weight loss or gross toxicity has been reported. Standard safety precautions should be followed.
References

[1]. A peptide mimicking VGLL4 function acts as a YAP antagonist therapy against gastric cancer. Cancer Cell. 2014 Feb 10;25(2):166-80.

[2]. ACTN1 supports tumor growth by inhibiting Hippo signaling in hepatocellular carcinoma. J Exp Clin Cancer Res. 2021 Jan 7;40(1):23.

Additional Infomation
Super-TDU (1-31) TFA is a research compound that has not entered clinical trials or received regulatory approval for human use. It is derived from Super-TDU, which is based on the YAP-binding domain of TEAD. This peptide is a valuable tool for studying Hippo signaling and for validating YAP as a therapeutic target in cancer. For research use only. Sequence shortening: SVDDHFAKSLGDTWLQIGGSGNPKTANVPQT.
These protocols are for reference only. InvivoChem does not independently validate these methods.
Physicochemical Properties
Molecular Formula
C141H218N40O48.C2HF3O2
Molecular Weight
3355.50
Related CAS #
Super-TDU (1-31)
Appearance
Solid powder
HS Tariff Code
2934.99.9001
Storage

Powder      -20°C    3 years

                     4°C     2 years

In solvent   -80°C    6 months

                  -20°C    1 month

Note: Please store this product in a sealed and protected environment (e.g. under nitrogen), avoid exposure to moisture and light.
Shipping Condition
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
Solubility Data
Solubility (In Vitro)
H2O :~50 mg/mL (~14.90 mM)
Solubility (In Vivo)
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.

Injection Formulations
(e.g. IP/IV/IM/SC)
Injection Formulation 1: DMSO : Tween 80: Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution 50 μL Tween 80 850 μL Saline)
*Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution.
Injection Formulation 2: DMSO : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO 400 μLPEG300 50 μL Tween 80 450 μL Saline)
Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO 900 μL Corn oil)
Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals).
View More

Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO 900 μL (20% SBE-β-CD in saline)]
*Preparation of 20% SBE-β-CD in Saline (4°C,1 week): Dissolve 2 g SBE-β-CD in 10 mL saline to obtain a clear solution.
Injection Formulation 5: 2-Hydroxypropyl-β-cyclodextrin : Saline = 50 : 50 (i.e. 500 μL 2-Hydroxypropyl-β-cyclodextrin 500 μL Saline)
Injection Formulation 6: DMSO : PEG300 : castor oil : Saline = 5 : 10 : 20 : 65 (i.e. 50 μL DMSO 100 μLPEG300 200 μL castor oil 650 μL Saline)
Injection Formulation 7: Ethanol : Cremophor : Saline = 10: 10 : 80 (i.e. 100 μL Ethanol 100 μL Cremophor 800 μL Saline)
Injection Formulation 8: Dissolve in Cremophor/Ethanol (50 : 50), then diluted by Saline
Injection Formulation 9: EtOH : Corn oil = 10 : 90 (i.e. 100 μL EtOH 900 μL Corn oil)
Injection Formulation 10: EtOH : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL EtOH 400 μLPEG300 50 μL Tween 80 450 μL Saline)


Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium)
Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose
Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals).
View More

Oral Formulation 3: Dissolved in PEG400
Oral Formulation 4: Suspend in 0.2% Carboxymethyl cellulose
Oral Formulation 5: Dissolve in 0.25% Tween 80 and 0.5% Carboxymethyl cellulose
Oral Formulation 6: Mixing with food powders


Note: Please be aware that the above formulations are for reference only. InvivoChem strongly recommends customers to read literature methods/protocols carefully before determining which formulation you should use for in vivo studies, as different compounds have different solubility properties and have to be formulated differently.

 (Please use freshly prepared in vivo formulations for optimal results.)
Preparing Stock Solutions 1 mg 5 mg 10 mg
1 mM 0.2980 mL 1.4901 mL 2.9802 mL
5 mM 0.0596 mL 0.2980 mL 0.5960 mL
10 mM 0.0298 mL 0.1490 mL 0.2980 mL

*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.

Calculator

Molarity Calculator allows you to calculate the mass, volume, and/or concentration required for a solution, as detailed below:

  • Calculate the Mass of a compound required to prepare a solution of known volume and concentration
  • Calculate the Volume of solution required to dissolve a compound of known mass to a desired concentration
  • Calculate the Concentration of a solution resulting from a known mass of compound in a specific volume
An example of molarity calculation using the molarity calculator is shown below:
What is the mass of compound required to make a 10 mM stock solution in 5 ml of DMSO given that the molecular weight of the compound is 350.26 g/mol?
  • Enter 350.26 in the Molecular Weight (MW) box
  • Enter 10 in the Concentration box and choose the correct unit (mM)
  • Enter 5 in the Volume box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 17.513 mg appears in the Mass box. In a similar way, you may calculate the volume and concentration.

Dilution Calculator allows you to calculate how to dilute a stock solution of known concentrations. For example, you may Enter C1, C2 & V2 to calculate V1, as detailed below:

What volume of a given 10 mM stock solution is required to make 25 ml of a 25 μM solution?
Using the equation C1V1 = C2V2, where C1=10 mM, C2=25 μM, V2=25 ml and V1 is the unknown:
  • Enter 10 into the Concentration (Start) box and choose the correct unit (mM)
  • Enter 25 into the Concentration (End) box and select the correct unit (mM)
  • Enter 25 into the Volume (End) box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 62.5 μL (0.1 ml) appears in the Volume (Start) box
g/mol

Molecular Weight Calculator allows you to calculate the molar mass and elemental composition of a compound, as detailed below:

Note: Chemical formula is case sensitive: C12H18N3O4  c12h18n3o4
Instructions to calculate molar mass (molecular weight) of a chemical compound:
  • To calculate molar mass of a chemical compound, please enter the chemical/molecular formula and click the “Calculate’ button.
Definitions of molecular mass, molecular weight, molar mass and molar weight:
  • Molecular mass (or molecular weight) is the mass of one molecule of a substance and is expressed in the unified atomic mass units (u). (1 u is equal to 1/12 the mass of one atom of carbon-12)
  • Molar mass (molar weight) is the mass of one mole of a substance and is expressed in g/mol.
/

Reconstitution Calculator allows you to calculate the volume of solvent required to reconstitute your vial.

  • Enter the mass of the reagent and the desired reconstitution concentration as well as the correct units
  • Click the “Calculate” button
  • The answer appears in the Volume (to add to vial) box
In vivo Formulation Calculator (Clear solution)
Step 1: Enter information below (Recommended: An additional animal to make allowance for loss during the experiment)
Step 2: Enter in vivo formulation (This is only a calculator, not the exact formulation for a specific product. Please contact us first if there is no in vivo formulation in the solubility section.)
+
+
+

Calculation results

Working concentration mg/mL;

Method for preparing DMSO stock solution mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.

Method for preparing in vivo formulation:Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O,mix and clarify.

(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
             (2) Be sure to add the solvent(s) in order.

Contact Us