| Size | Price | Stock | Qty |
|---|---|---|---|
| 1mg |
|
||
| 5mg |
|
||
| 10mg |
|
||
| Other Sizes |
| ln Vitro |
ACTH 1-39 is non-toxic to neurons in the concentration range of 100-400 nM, but it protects neurons from excitotoxic neuronal death induced by glutamate (100 μM), NMDA (1 mM), AMPA (50 μM), and phycocyanine (25 μM). 400 nM ACTH provides significant protection in all of these cases. Both 200 nM and 400 nM ACTH protect neurons from damage caused by quinolinic acid (25 μM). ACTH also protects neurons from 2 μM H₂O₂-induced cell death (H₂O₂ produces reactive oxygen species (ROS)), with 400 nM ACTH showing significantly stronger protection than 200 nM. ACTH provides some protection against rapidly released nitric oxide (NO) from NOC-12, but not against slowly released nitric oxide from NOC-18. ACTH (200 or 400 nM) can protect neurons from the cytotoxic effects of asteroids (10-20 nM), a classic drug that induces cell death through apoptosis. ACTH can reduce the cell death rate from 80% to 55%[1].
|
|---|---|
| ln Vivo |
Compared with the saline/IgG group, intraventricular injection of ACTH significantly reduced cumulative food intake during the observation period. Injection of ACTH antibody into the paraventricular nucleus (PVN) eliminated the anorexia of ACTH. In rats injected with α-MSH antibody into the PVN and ACTH into the ventricle, intraventricular infusion of ACTH significantly reduced cumulative food intake, which was as low as that of the intraventricular ACTH injection and PVN IgG injection groups. Compared with the IgG treatment group, injection of ACTH antibody or α-MSH antibody into the PVN significantly increased cumulative food intake; the combined use of the two antibodies did not further increase food intake [2].
|
| References |
|
| Molecular Formula |
C210H315N57O57S.XC2HF3O2
|
|---|---|
| Molecular Weight |
4582.23 (free acid)
|
| Related CAS # |
Adrenocorticotropic hormone (1-39), rat
|
| Sequence |
Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-PheSYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
|
| SequenceShortening |
SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
|
| Appearance |
White to off-white solid
|
| Synonyms |
ACTH(1-39), rat TFA
|
| HS Tariff Code |
2934.99.9001
|
| Storage |
Powder -20°C 3 years 4°C 2 years In solvent -80°C 6 months -20°C 1 month Note: 请将本产品存放在密封保护的环境中，避免受潮。 |
| Shipping Condition |
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
|
| Solubility (In Vitro) |
H2O : ~100 mg/mL (with sonication)
DMSO : ~100 mg/mL (with sonication) |
|---|---|
| Solubility (In Vivo) |
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.
Injection Formulations
Injection Formulation 1: DMSO : Tween 80： Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution → 50 μL Tween 80 → 850 μL Saline)(e.g. IP/IV/IM/SC) *Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution. Injection Formulation 2: DMSO : PEG300 ：Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO → 400 μLPEG300 → 50 μL Tween 80 → 450 μL Saline) Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO → 900 μL Corn oil) Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals). View More
Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO → 900 μL (20% SBE-β-CD in saline)] Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium) Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals). View More
Oral Formulation 3: Dissolved in PEG400 (Please use freshly prepared in vivo formulations for optimal results.) |
Calculation results
Working concentration： mg/mL；
Method for preparing DMSO stock solution： mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.
Method for preparing in vivo formulation:：Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O，mix and clarify.
(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
(2) Be sure to add the solvent(s) in order.
Products are for research use only; We do not sell to patients
Copyright 2020 InvivoChem LLC | All Rights Reserved
