| Size | Price | Stock | Qty |
|---|---|---|---|
| 1mg |
|
||
| 5mg |
|
||
| 10mg |
|
||
| Other Sizes |
| Targets |
Adrenotensin targets the CGRP receptor family and interacts with receptors composed of CRLR and RAMP protein complexes. It also modulates GPCR/G Protein signaling pathways and cardiovascular system, as ADM has been reported to bind to MRGPR and activate cAMP signaling.
|
|---|---|
| ln Vitro |
In vitro, Adrenotensin activates the cAMP signaling pathway upon binding to its receptor complex consisting of CRLR and RAMP proteins. This activation leads to the regulation of vasodilation and inhibition of pro-inflammatory cytokine release. Additionally, ADM and its precursor peptides exhibit interactions with angiotensin II in renal interstitial cells, influencing DNA synthesis and extracellular matrix accumulation.
|
| ln Vivo |
In vivo preclinical data from sepsis models indicate that ADM and its fragments exert anti-inflammatory, antimicrobial, and protective effects on endothelial barrier function. However, administration may also decrease blood pressure, which could be detrimental in certain conditions such as septic shock.
|
| Enzyme Assay |
Competitive binding assays are performed using radiolabeled ADM and cell membranes expressing CGRP receptors. The assay buffer contains 50 mM Tris-HCl pH 7.4 and 0.1% BSA. Test compound at various concentrations is incubated with 0.1 nM [125I]-ADM and 10 ug membrane protein for 60 min at 25degC. Bound radioactivity is separated by filtration through GF/B filters presoaked in 0.3% PEI, and quantified by gamma counting.
|
| Cell Assay |
HEK293 cells stably expressing recombinant CGRP receptors (CRLR + RAMP1/2/3) are seeded in 96-well plates at 2×10⁴ cells/well and cultured for 24 hours. Cells are washed with PBS and incubated with varying concentrations of test compound for 15 min at 37degC, followed by stimulation with ADM. Intracellular cAMP levels are measured using a homogeneous time-resolved fluorescence (HTRF) cAMP assay kit according to the manufacturer protocol.
|
| Animal Protocol |
Male Sprague-Dawley rats (200-250g) are anesthetized and instrumented for blood pressure monitoring via carotid artery cannulation. Test compound is administered intravenously via femoral vein at doses of 0.1, 0.3, and 1.0 mg/kg. Blood samples are collected at predetermined time points (0, 5, 15, 30, 60, 120 min) for plasma ADM concentration analysis by ELISA. Hemodynamic parameters including mean arterial pressure are continuously recorded.
|
| ADME/Pharmacokinetics |
Like other vasoactive peptides, peptides containing multiple positive charges may exhibit rapid clearance from circulation via renal excretion and proteolytic degradation. Half-life is typically short (minutes) and metabolic stability can be improved by modifications like cyclization or unnatural amino acid substitution. ADM itself has a half-life of approximately 22 minutes in humans due to rapid degradation by neutral endopeptidase.
|
| Toxicity/Toxicokinetics |
As a bioactive peptide fragment, its toxicity profile is generally consistent with the parent molecule ADM. Overdose may cause hypotension and reflex tachycardia. No significant organ-specific toxicity or genotoxicity has been reported for this peptide. Standard acute toxicity studies in rodents would determine the maximum tolerated dose and NOAEL for long-term safety evaluation.
|
| References | |
| Additional Infomation |
This compound is a human peptide fragment supplied as TFA salt. Its molecular formula is C143H224N42O43·xC2H3O2 and free base molecular weight is 3219.56. The sequence is SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHPLF. It is recommended to store powder at -20degC and avoid repeated freeze-thaw cycles.
|
| Molecular Formula |
C143H224N42O43.XC2HF3O2
|
|---|---|
| Molecular Weight |
3219.56 (free base)
|
| Related CAS # |
Adrenotensin (human); 166546-72-1
|
| Sequence |
Ser-Leu-Pro-Glu-Ala-Gly-Pro-Gly-Arg-Thr-Leu-Val-Ser-Ser-Lys-Pro-Gln-Ala-His-Gly-Ala-Pro-Ala-Pro-Pro-Ser-Gly-Ser-Ala-Pro-His-Phe-LeuSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL
|
| Appearance |
White to off-white solid powder
|
| Synonyms |
Pro-ADM-153-185 (human) TFA
|
| HS Tariff Code |
2934.99.9001
|
| Storage |
Powder -20°C 3 years 4°C 2 years In solvent -80°C 6 months -20°C 1 month Note: Please store this product in a sealed and protected environment, avoid exposure to moisture. |
| Shipping Condition |
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
|
| Solubility (In Vitro) |
May dissolve in DMSO (in most cases), if not, try other solvents such as H2O, Ethanol, or DMF with a minute amount of products to avoid loss of samples
|
|---|---|
| Solubility (In Vivo) |
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.
Injection Formulations
Injection Formulation 1: DMSO : Tween 80： Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution → 50 μL Tween 80 → 850 μL Saline)(e.g. IP/IV/IM/SC) *Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution. Injection Formulation 2: DMSO : PEG300 ：Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO → 400 μLPEG300 → 50 μL Tween 80 → 450 μL Saline) Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO → 900 μL Corn oil) Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals). View More
Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO → 900 μL (20% SBE-β-CD in saline)] Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium) Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals). View More
Oral Formulation 3: Dissolved in PEG400 (Please use freshly prepared in vivo formulations for optimal results.) |
Calculation results
Working concentration： mg/mL；
Method for preparing DMSO stock solution： mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.
Method for preparing in vivo formulation:：Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O，mix and clarify.
(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
(2) Be sure to add the solvent(s) in order.
Products are for research use only; We do not sell to patients
Copyright 2020 InvivoChem LLC | All Rights Reserved
