| Size | Price | Stock | Qty |
|---|---|---|---|
| 1mg |
|
||
| 5mg |
|
||
| 10mg |
|
||
| 25mg |
|
||
| 50mg | |||
| Other Sizes |
Teduglutide (ALX-0600) is a glucagon-like peptide 2 (GLP-2) analogue with the potential to be used for short bowel syndrome (SBS) and Crohn's disease (CD). It has higher stability than GLP-2 as it is dipeptidyl peptidase IV resistant.
| ADME/Pharmacokinetics |
Absorption, Distribution and Excretion
The pharmacokinetic characteristics of terduglutide administered subcutaneously conform to a one-compartment model, with first-order kinetics in the abdomen, arm, and thigh. The pharmacokinetics of terduglutide exhibit a linear relationship with increasing dose. The absolute bioavailability after subcutaneous injection is 88%; the time to peak concentration (Tmax) after subcutaneous injection is 3–5 hours; the peak plasma concentration (Cmax) in patients with short bowel syndrome (SBS) after subcutaneous injection of 0.05 mg/kg is 36 ng/mL; the area under the curve (AUC) in patients with short bowel syndrome (SBS) after subcutaneous injection of 0.05 mg/kg is 0.15 µg•hr/mL; terduglutide does not accumulate after multiple subcutaneous injections. Urine Volume of distribution (Vd), healthy subjects = 103 mL/kg Plasma clearance, healthy subjects = 123 mL/hr/kg; this value indicates that terdugraftide is primarily cleared by the kidneys. In healthy subjects, the volume of distribution of terdugraftide (103 mL/kg) is similar to that of blood volume. In healthy subjects, the absolute bioavailability of subcutaneously administered Gattex is 88%, with peak plasma terdugraftide concentrations reached 3–5 hours after administration. In patients with short bowel syndrome (SBS), after subcutaneous administration of a dose of 0.05 mg/kg, the median peak concentration (Cmax) of terdugraftide was 36 ng/mL, and the median area under the curve (AUC0-inf) was 0.15 μghr/mL. No accumulation of terdugraftide was observed after repeated subcutaneous administration. /Breast milk/ It is unclear whether Gattex is present in human breast milk. Terdugratide is secreted into the milk of lactating rats, with the highest concentration detected in milk after a single subcutaneous injection of 25 mg/kg being 2.9% of the plasma concentration. Terdugratide is a recombinant analog of human glucagon-like peptide-2 and has recently been approved for the treatment of short bowel syndrome in adults. This study aimed to investigate the effects of renal function and age on the pharmacokinetics of terdugratide. This was an open-label study with six parallel groups (6 subjects per group). Three renal impairment groups (moderate, severe, and end-stage renal disease) were compared with healthy subjects with normal renal function, and the baseline characteristics of the healthy subjects were matched to those of the renal impairment groups. At least two elderly subjects (≥65 years) were included in each group. Each subject received a single subcutaneous injection of 10 mg terdugratide. Plasma concentrations of terdugratide were determined using validated liquid chromatography-tandem mass spectrometry, and the main pharmacokinetic parameters (AUCinf and Cmax) were calculated. Patients with end-stage renal disease had approximately 2.59-fold and 2.08-fold higher area under the concentration-time curve (AUCinf) and maximum plasma concentration (Cmax) of terdugraft, respectively, compared to healthy subjects. Patients with moderate to severe renal impairment also showed slightly higher AUCinf and Cmax. Comparison of healthy subjects <65 years of age and older healthy subjects revealed very similar pharmacokinetic characteristics between the two groups. In this study population, the major pharmacokinetic parameters of terdugraft increased with increasing renal impairment. These results suggest that the daily dose of terdugraft should be reduced by 50% for patients with moderate to severe renal impairment and end-stage renal disease. We found that age had no effect on the pharmacokinetics of terdugraft in healthy subjects. Treatment was well tolerated, and no safety issues were observed. Metabolism/Metabolites Although formal studies have not been conducted, as terdugraft is a peptide drug, it is expected to degrade into smaller peptides and amino acids via catabolic pathways. The cytochrome P450 enzyme system is not involved in the metabolism of this drug. The metabolic pathway of terduglutide has not been studied in humans. However, it is expected that terduglutide will be degraded into small peptides and amino acids via a catabolic pathway, similar to the catabolic metabolism of endogenous GLP-2. Biological Half-Life The terminal half-life in healthy subjects is 2 hours; terminal half-life in SBS patients = 1.3 hours. The mean terminal half-life of terduglutide in healthy subjects is approximately 2 hours, and the mean terminal half-life in patients with short bowel syndrome (SBS) is 1.3 hours. |
|---|---|
| Toxicity/Toxicokinetics |
Toxicity Summary
Identification and Use: Terdugranitide is a biosynthetic (recombinant DNA-derived) analog of human glucagon-like peptide-2 (GLP-2), a pleiotropic hormone that promotes intestinal mucosal growth and affects intestinal function. This product is indicated for the treatment of adult patients with short bowel syndrome (SBS) who require parenteral nutrition support. Human Exposure and Toxicity: Based on pharmacological activity and studies in animals, this drug may cause proliferative changes, including tumors. In clinical studies, gastrointestinal polyps (e.g., colorectal polyps, duodenal polyps, and peristomal polyps, including hyperplastic polyps and villous adenomas) have been detected in patients treated with this drug. Several patients treated with terdugranitide have reported malignant tumors, including one patient who had previously received abdominal radiotherapy for Hodgkin's lymphoma and developed metastatic adenocarcinoma of unknown origin, and two patients with a history of smoking and developed lung cancer (squamous cell carcinoma and non-small cell carcinoma). Animal studies: In a two-year carcinogenicity study, subcutaneous injections of terduglutide in rats at doses of 3, 10, and 35 mg/kg/day (approximately 60, 200, and 700 times the recommended human daily dose of 0.05 mg/kg, respectively) significantly increased the incidence of bile duct and jejunal adenomas in male rats. In a two-year carcinogenicity study in mice, subcutaneous injections of terduglutide at doses of 1, 3.5, and 12.5 mg/kg/day (approximately 20, 70, and 250 times the recommended human daily dose of 0.05 mg/kg, respectively) significantly increased the incidence of papillary adenomas of the gallbladder; at a high dose of 12.5 mg/kg/day (approximately 250 times the recommended human dose), it also induced jejunal adenocarcinoma in male mice. Animal studies have shown that subcutaneous injection of terduglutide at doses up to 50 mg/kg/day (approximately 1000 times the recommended human daily dose of 0.05 mg/kg) has no effect on embryo-fetal development in pregnant rats and rabbits. A rat prenatal and postnatal development study showed that subcutaneous injection of terduglutide at doses up to 50 mg/kg/day (approximately 1000 times the recommended human daily dose of 0.05 mg/kg) had no adverse effects on prenatal and postnatal development. Furthermore, subcutaneous injection of terduglutide at doses up to 50 mg/kg/day (approximately 1000 times the recommended human daily dose of 0.05 mg/kg) also had no adverse effects on fertility and reproductive function in male and female rats. Terduglutide was negative in the Ames test, the Chinese hamster ovary cell chromosomal aberration test, and the in vivo mouse micronucleus test. Effects during pregnancy and lactation ◉ Overview of use during lactation Because Teduglutide is a large protein molecule with a molecular weight of 3752 Da, its concentration in breast milk is likely to be very low. Furthermore, Teduglutide has a low oral absorption rate, so it is unlikely to be absorbed by breastfed infants. Two breastfed infants appeared to have no adverse effects while their mothers were using Teduglutide, but long-term data are currently unavailable. Infants should be closely monitored during breastfeeding when using Teduglutide until more data are available. ◉ Effects on breastfed infants One mother used Teduglutide during pregnancy and postpartum lactation. She breastfed her infant for 6 months (breastfeeding duration not specified). No adverse effects on the infant were reported. A woman who took Teduglutide due to partial gastrointestinal resection became pregnant and delivered a healthy infant. She breastfed her infant and restarted the medication 1 month postpartum. During treatment, she breastfed her infant for 4 months (feeding extent not specified). The infant experienced no side effects during breastfeeding. ◉ Effects on breastfeeding and breast milk As of the revision date, no relevant published information was found. Drug Interactions Tetugglutide may increase intestinal absorption of the drug and should therefore be used with caution in patients receiving oral treatment with central nervous system medications (e.g., benzodiazepines, antipsychotics), medications requiring dose adjustment, or medications with a narrow therapeutic index. |
| References |
|
| Additional Infomation |
Teduglutide is a polypeptide composed of 33 amino acid residues with the following sequence: His, Gly, Asp, Gly, Ser, Phe, Ser, Asp, Glu, Met, Asn, Thr, Ile, Leu, Asp, Asn, Leu, Ala, Ala, Arg, Asp, Phe, Ile, Asn, Trp, Leu, Ile, Gln, Thr, Lys, Ile, Thr, and Asp. It is a glucagon-like peptide-2 receptor agonist used to treat short bowel syndrome. Teduglutide has multiple functions, including acting as a glucagon-like peptide-2 receptor agonist, a metabolite, an antioxidant, and a protectant. Teduglutide is a glucagon-like peptide-2 (GLP-2) analog. It consists of 33 amino acids and is produced using recombinant DNA technology-modified E. coli strains. Teduglutide differs from GLP-2 only in one amino acid (alanine is replaced by glycine). The significance of this amino acid substitution is that terdulglutide has a longer duration of action than endogenous GLP-2 because it is more resistant to the proteolytic activity of dipeptidyl peptidase-4. The FDA approved it on December 21, 2012.
Drug Indications Terdulglutide is indicated for the treatment of adult and pediatric patients aged 1 year and older who require parenteral nutrition support for short bowel syndrome (SBS). FDA Label Revestive is indicated for the treatment of patients aged 1 year and older with short bowel syndrome (SBS). Patients should be stable after a period of bowel adaptation post-surgery. Revestive is indicated for the treatment of patients aged 1 year and older with short bowel syndrome. Patients should be stable after a period of bowel adaptation post-surgery. Treatment of Short Bowel Syndrome Mechanism of Action Tedugglutide is an analogue of natural human glucagon-like peptide-2 (GLP-2), a peptide secreted by L cells in the distal intestine after eating. GLP-2 increases intestinal and portal venous blood flow and inhibits gastric acid secretion. Tedugglutide binds to glucagon-like peptide-2 receptors located in enteroendocrine cells, submucosal myofibroblasts, and enteric neurons in the submucosal and myenteric plexuses. This leads to the release of insulin-like growth factor (IGF)-1, nitric oxide, and keratinocyte growth factor (KGF). These growth factors may contribute to increasing the growth and surface area of gastric mucosal crypt cells. Ultimately, intestinal absorption is enhanced. Compared to natural GLP-2, tedugglutide has a similar affinity for the human and rat GLP-2 receptor (GLP-2R). Receptor binding leads to increased intracellular cyclic adenosine monophosphate (cAMP) levels and activates multiple downstream signaling pathways, such as protein kinase A (PKA), cAMP response element-binding protein (CREB), and activator protein-1 (AP-1). Terdugratin's potency against GLP-2R is comparable to that of natural GLP-2, but its enhanced biological activity, resulting in a prolonged circulating half-life, is due to its resistance to DPP-IV cleavage. Terdugratin is an analog of natural human glucagon-like peptide-2 (GLP-2), a peptide secreted by L cells in the distal intestine. GLP-2 is known to increase intestinal and portal venous blood flow and inhibit gastric acid secretion. Terdugratin binds to glucagon-like peptide-2 receptors located in intestinal endocrine cell subsets, submucosal myofibroblasts, and enteric neurons in the submucosal and myenteric plexus. Activation of these receptors leads to the local release of various mediators, including insulin-like growth factor (IGF)-1, nitric oxide, and keratinocyte growth factor (KGF). Therapeutic Use /Clinical Trials/ ClinicalTrials.gov is a registry and results database that lists publicly and privately funded human clinical studies conducted worldwide. The website is maintained by the National Library of Medicine (NLM) and the National Institutes of Health (NIH). Each record on ClinicalTrials.gov provides summary information on the study protocol, including: the disease or condition; the intervention (e.g., the medical product, behavior, or procedure under investigation); the title, description, and design of the study; participation requirements (eligibility criteria); the location of the study; contact information for the study location; and links to relevant information from other health websites, such as the NLM's MedlinePlus (for patient health information) and PubMed (for citations and abstracts of academic articles in the medical field). The database contains terdugraftide. Tettex for injection (recombinant DNA source) is indicated for the treatment of adult patients with short bowel syndrome (SBS) who require parenteral nutrition support. /Included on US product labels/ /Therapeutic Use/ Currently available medications for treating Crohn's disease (CD) include aminosalicylates, corticosteroids, antibiotics, immunomodulators, and biologics (infliximab, cetrus, adalimumab, and natezumab). These drugs primarily target the immune and inflammatory pathways of Crohn's disease (CD), while drugs targeting the impaired intestinal barrier function in CD patients are scarce. Glucagon-like peptide-2 (GLP-2) is an incretin with significant nutritional effects on the intestinal mucosa. Teduglutide, an analogue of GLP-2, has been approved by the US Food and Drug Administration (FDA) for the treatment of short bowel syndrome. This article explores the potential use of teduglutide in CD patients. Due to the limited number of randomized, placebo-controlled trials currently available on teduglutide for CD, data on its efficacy in treating CD are lacking. This article uses the Medline database, searching for keywords including: teduglutide, GLP-2, CD, and inflammatory bowel disease. Based on the available data, it can be concluded that this drug appears to be a promising treatment for CD, but further trials are needed to determine the role of terduglutide in CD treatment. Drug Warnings Based on animal pharmacological activity and study results, Gattex may cause proliferative changes, including tumorigenesis. For patients at high risk of malignancy, Gattex should only be considered when the benefits outweigh the risks. For patients with active gastrointestinal malignancies (gastrointestinal tract, hepatobiliary, pancreas), Gattex treatment should be discontinued.For patients with active non-gastrointestinal malignancies, the clinical decision on whether to continue using Gattex should be based on a risk-benefit ratio consideration. In controlled clinical trials of terdugraftide at the recommended dose for short bowel syndrome, adverse reactions were reported in 5% or more of patients, with a higher incidence in the treatment group than in the placebo group. These adverse reactions included gastrostomy complications (in patients with an ostomy), abdominal pain, upper respiratory tract infection, nausea, abdominal distension, vomiting, fluid retention, flatulence, allergic reactions, appetite disturbances, sleep disturbances, cough, and skin bleeding. Reports of injection site reactions and headache were also common in all clinical studies. Terdugraftide may increase intestinal absorption and should therefore be used with caution in patients concurrently receiving oral central nervous system medications (e.g., benzodiazepines, antipsychotics), medications requiring dose adjustment, or medications with a narrow therapeutic index. Terdugraftide increases fluid absorption, which may induce or exacerbate congestive heart failure. Fluid overload and congestive heart failure have been reported in patients receiving terdugraftide in clinical trials. In controlled clinical trials, 9 out of 77 patients (11.7%) receiving 0.05 mg/kg terdugraft daily reported fluid overload, compared to 4 out of 59 patients (6.8%) receiving placebo. Fluid status should be routinely monitored, and parenteral nutrition support adjusted accordingly. Patients with cardiovascular disease (e.g., heart failure, hypertension) should be monitored for fluid overload, especially during the initiation of terdugraft treatment. If fluid overload occurs, parenteral nutrition support should be reduced, and terdugraft treatment should be reassessed, especially in patients with cardiovascular disease. If clinically significant deterioration of cardiac function occurs, the need for continued terdugraft treatment should be reassessed. For more complete (14) drug warnings regarding terdugraft, please visit the HSDB record page. Pharmacodynamics After daily administration of terdugraftide, increased gastrointestinal fluid absorption (750-1000 mL/day) was observed. Increased intestinal villus height and crypt depth were also observed. Furthermore, decreased stool weight was observed. Terdugraftide does not prolong the QTc interval. |
| Molecular Formula |
C164H252N44O55S
|
|---|---|
| Molecular Weight |
3752.08247999998
|
| Exact Mass |
3749.8
|
| CAS # |
197922-42-2
|
| Related CAS # |
Teduglutide TFA
|
| PubChem CID |
16139605
|
| Sequence |
H-His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
L-histidyl-glycyl-L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-aspartic acid |
| SequenceShortening |
HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
|
| Appearance |
White to off-white solid powder
|
| LogP |
1.016
|
| Hydrogen Bond Donor Count |
55
|
| Hydrogen Bond Acceptor Count |
60
|
| Rotatable Bond Count |
126
|
| Heavy Atom Count |
264
|
| Complexity |
9030
|
| Defined Atom Stereocenter Count |
38
|
| SMILES |
CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)[C@H](CC5=CN=CN5)N
|
| InChi Key |
CILIXQOJUNDIDU-ASQIGDHWSA-N
|
| InChi Code |
InChI=1S/C164H252N44O55S/c1-21-77(11)126(156(255)187-95(44-46-114(167)214)141(240)206-130(83(17)211)160(259)186-93(42-33-34-49-165)140(239)202-129(80(14)24-4)159(258)208-131(84(18)212)161(260)200-111(163(262)263)66-125(230)231)203-151(250)100(54-76(9)10)189-145(244)103(57-88-67-175-92-41-32-31-40-90(88)92)192-147(246)105(60-116(169)216)199-157(256)127(78(12)22-2)204-152(251)102(56-87-38-29-26-30-39-87)190-149(248)109(64-123(226)227)195-137(236)94(43-35-50-174-164(171)172)183-134(233)82(16)179-133(232)81(15)180-142(241)98(52-74(5)6)188-146(245)104(59-115(168)215)194-150(249)110(65-124(228)229)196-143(242)99(53-75(7)8)198-158(257)128(79(13)23-3)205-162(261)132(85(19)213)207-153(252)106(61-117(170)217)193-139(238)97(48-51-264-20)185-138(237)96(45-47-120(220)221)184-148(247)108(63-122(224)225)197-155(254)113(72-210)201-144(243)101(55-86-36-27-25-28-37-86)191-154(253)112(71-209)182-119(219)70-177-136(235)107(62-121(222)223)181-118(218)69-176-135(234)91(166)58-89-68-173-73-178-89/h25-32,36-41,67-68,73-85,91,93-113,126-132,175,209-213H,21-24,33-35,42-66,69-72,165-166H2,1-20H3,(H2,167,214)(H2,168,215)(H2,169,216)(H2,170,217)(H,173,178)(H,176,234)(H,177,235)(H,179,232)(H,180,241)(H,181,218)(H,182,219)(H,183,233)(H,184,247)(H,185,237)(H,186,259)(H,187,255)(H,188,245)(H,189,244)(H,190,248)(H,191,253)(H,192,246)(H,193,238)(H,194,249)(H,195,236)(H,196,242)(H,197,254)(H,198,257)(H,199,256)(H,200,260)(H,201,243)(H,202,239)(H,203,250)(H,204,251)(H,205,261)(H,206,240)(H,207,252)(H,208,258)(H,220,221)(H,222,223)(H,224,225)(H,226,227)(H,228,229)(H,230,231)(H,262,263)(H4,171,172,174)/t77-,78-,79-,80-,81-,82-,83+,84+,85+,91-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,126-,127-,128-,129-,130-,131-,132-/m0/s1
|
| Chemical Name |
(2S)-2-[[(2S,3R)-2-[[(2S,3S)-2-[[(2S)-6-amino-2-[[(2S,3R)-2-[[(2S)-5-amino-2-[[(2S,3S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S,3S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S)-2-[[(2S)-2-[[(2S,3S)-2-[[(2S,3R)-2-[[(2S)-4-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[2-[[(2S)-2-amino-3-(1H-imidazol-5-yl)propanoyl]amino]acetyl]amino]-3-carboxypropanoyl]amino]acetyl]amino]-3-hydroxypropanoyl]amino]-3-phenylpropanoyl]amino]-3-hydroxypropanoyl]amino]-3-carboxypropanoyl]amino]-4-carboxybutanoyl]amino]-4-methylsulfanylbutanoyl]amino]-4-oxobutanoyl]amino]-3-hydroxybutanoyl]amino]-3-methylpentanoyl]amino]-4-methylpentanoyl]amino]-3-carboxypropanoyl]amino]-4-oxobutanoyl]amino]-4-methylpentanoyl]amino]propanoyl]amino]propanoyl]amino]-5-carbamimidamidopentanoyl]amino]-3-carboxypropanoyl]amino]-3-phenylpropanoyl]amino]-3-methylpentanoyl]amino]-4-oxobutanoyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]-4-methylpentanoyl]amino]-3-methylpentanoyl]amino]-5-oxopentanoyl]amino]-3-hydroxybutanoyl]amino]hexanoyl]amino]-3-methylpentanoyl]amino]-3-hydroxybutanoyl]amino]butanedioic acid
|
| Synonyms |
Teduglutide; ALX-0600; ALX0600; Gattex; 197922-42-2; revestive;
|
| HS Tariff Code |
2934.99.9001
|
| Storage |
Powder -20°C 3 years 4°C 2 years In solvent -80°C 6 months -20°C 1 month Note: Please store this product in a sealed and protected environment (e.g. under nitrogen), avoid exposure to moisture and light. |
| Shipping Condition |
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
|
| Solubility (In Vitro) |
DMSO : ~50 mg/mL (~13.33 mM)
H2O : ~22.22 mg/mL (~5.92 mM) |
|---|---|
| Solubility (In Vivo) |
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.
Injection Formulations
Injection Formulation 1: DMSO : Tween 80: Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution → 50 μL Tween 80 → 850 μL Saline)(e.g. IP/IV/IM/SC) *Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution. Injection Formulation 2: DMSO : PEG300 :Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO → 400 μLPEG300 → 50 μL Tween 80 → 450 μL Saline) Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO → 900 μL Corn oil) Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals). View More
Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO → 900 μL (20% SBE-β-CD in saline)] Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium) Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals). View More
Oral Formulation 3: Dissolved in PEG400  (Please use freshly prepared in vivo formulations for optimal results.) |
| Preparing Stock Solutions | 1 mg | 5 mg | 10 mg | |
| 1 mM | 0.2665 mL | 1.3326 mL | 2.6652 mL | |
| 5 mM | 0.0533 mL | 0.2665 mL | 0.5330 mL | |
| 10 mM | 0.0267 mL | 0.1333 mL | 0.2665 mL |
*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.
Calculation results
Working concentration: mg/mL;
Method for preparing DMSO stock solution: mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.
Method for preparing in vivo formulation::Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O,mix and clarify.
(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
(2) Be sure to add the solvent(s) in order.
Link: https://clinicaltrials.gov/ct2/show/NCT05023382
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT07400783
Conditions:Short Bowel Syndrome (SBS)Link: https://clinicaltrials.gov/ct2/show/NCT03562130
Conditions:Short Bowel Syndrome
Title:A Study of Teduglutide in Chinese Adults With Short Bowel Syndrome
Status:Recruiting
updateDate:2025-07-09
Ctid:NCT06973304
Link: https://clinicaltrials.gov/ct2/show/NCT06973304
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT02949362
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT05027308
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT04832087
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT04290429
Conditions:Graft Versus Host DiseaseLink: https://clinicaltrials.gov/ct2/show/NCT02431325
Conditions:HIVLink: https://clinicaltrials.gov/ct2/show/NCT03596164
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT03953170
Conditions:Ileostomy - StomaLink: https://clinicaltrials.gov/ct2/show/NCT04465396
Conditions:Healthy VolunteersLink: https://clinicaltrials.gov/ct2/show/NCT03422666
Conditions:HyperlipidemiasLink: https://clinicaltrials.gov/ct2/show/NCT03442972
Conditions:HyperlipidemiasLink: https://clinicaltrials.gov/ct2/show/NCT03268811
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT02980666
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT02889393
Conditions:Postoperative FistulaLink: https://clinicaltrials.gov/ct2/show/NCT03716115
Conditions:Severe Acute MalnutritionLink: https://clinicaltrials.gov/ct2/show/NCT00930644
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT01560403
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT02340819
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT02682381
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT00081458
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT01952080
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT04916665
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT01209351
Conditions:Healthy VolunteersLink: https://clinicaltrials.gov/ct2/show/NCT00798967
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT00172185
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT00820885
Conditions:Pharmacokinetics and Safety of Elevated DosesLink: https://clinicaltrials.gov/ct2/show/NCT00072839
Conditions:Crohn's DiseaseLink: https://clinicaltrials.gov/ct2/show/NCT00819468
Conditions:Hepatic ImpairmentLink: https://clinicaltrials.gov/ct2/show/NCT00308438
Conditions:Crohn's DiseaseLink: https://clinicaltrials.gov/ct2/show/NCT03571516
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT04857801
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT04733066
Conditions:Short Bowel Syndrome|Intestinal FailureLink: https://clinicaltrials.gov/ct2/show/NCT03663582
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT03534661
Conditions:HyperlipidemiasLink: https://clinicaltrials.gov/ct2/show/NCT02099084
Conditions:Short Bowel SyndromeLink: https://clinicaltrials.gov/ct2/show/NCT01028768
Conditions:Renal ImpairmentLink: https://clinicaltrials.gov/ct2/show/NCT01028924
Conditions:HealthyLink: https://www.clinicaltrialsregister.eu/ctr-search/search?query=2008-006193-15
Condition:Short Bowel SyndromeLink: https://www.clinicaltrialsregister.eu/ctr-search/search?query=2004-000439-27
Condition:Short Bowel Syndrome (SBS) refers to the clinical situation whereby a significant reduction in the absorptive capacity of the intestine results from inadequate anatomical or functional length of residual small intestine following surgical resection. These patients are highly prone to malnutrition, diarrhoea, and dehydration due to the reduced intestinal capacity to absorb macronutrients, water and electrolytes.Link: https://www.clinicaltrialsregister.eu/ctr-search/search?query=2004-000438-35
Condition:Short Bowel Syndrome (SBS) refers to the clinical situation whereby a significant reduction in the absorptive capacity of the intestine results from inadequate anatomical or functional length of residual small intestine following surgical resection. These patients are highly prone to malnutrition, diarrhea, and dehydration due to the reduced intestinal capacity to absorb macronutrients, water and electrolytes (1-8).Link: https://www.clinicaltrialsregister.eu/ctr-search/search?query=2017-001405-32
Condition:Short Bowel SyndromLink: https://www.clinicaltrialsregister.eu/ctr-search/search?query=2013-004588-30
Condition:Short Bowel Syndrome