yingweiwo

APTSTAT3-9R

Cat No.:V77246 Purity: ≥98%
APTSTAT3-9R is a specific STAT3-binding peptide that can inhibit STAT3 activation and downstream signaling by specifically blocking STAT3 phosphorylation.
APTSTAT3-9R
APTSTAT3-9R Chemical Structure Product category: JAK
This product is for research use only, not for human use. We do not sell to patients.
Size Price Stock Qty
1mg
5mg
Other Sizes
Official Supplier of:
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text

 

  • Business Relationship with 5000+ Clients Globally
  • Major Universities, Research Institutions, Biotech & Pharma
  • Citations by Top Journals: Nature, Cell, Science, etc.
Top Publications Citing lnvivochem Products
Product Description
APTSTAT3-9R is a specific STAT3-binding peptide that can inhibit STAT3 activation and downstream signaling by specifically blocking STAT3 phosphorylation. APTSTAT3-9R has antiproliferation and anticancer effects.
APTSTAT3-9R is a synthetic cell-permeable peptide inhibitor designed to target Signal Transducer and Activator of Transcription 3 (STAT3). It comprises a STAT3-specific aptide sequence (derived from phage display) conjugated to a nona-arginine (9R) cell-penetrating motif for efficient intracellular delivery.
Biological Activity I Assay Protocols (From Reference)
Targets
STAT3
STAT3 (Signal Transducer and Activator of Transcription 3), specifically the SH2 domain. APTSTAT3-9R binds to STAT3 with high specificity and affinity (Kd ≈ 231 nM), blocking STAT3 phosphorylation and subsequent dimerization, nuclear translocation, and transcriptional activity.
ln Vitro
In human lung cancer cells (A549), APTSTAT3-9R(7.5, 15, and 30 μmol/L; 6 hours) dramatically lowers STAT3–DNA-binding activity in a dose-dependent manner[1]. For two weeks, APTSTAT3-9R (30 μM) strongly inhibits the growth and viability of cancer cells, as well as the development of new colonies. IC50 values for APTSTAT3-9R in A549, B16F1, and HepG2 cells range from 10 to 20 μM [1]. The selectivity of the aptide is indicated by the efficient inhibition of STAT3 phosphorylation by APTSTAT3-9R (7.5, 15, and 30 μmol /L; 6 hours), while leaving AKT phosphorylation unaffected.
In various cancer cell lines (B16F1 melanoma, etc.), APTSTAT3-9R (1-10 uM) blocks STAT3 phosphorylation (p-STAT3) and reduces expression of STAT3 target genes including cyclin D1, Bcl-xL, and survivin. It suppresses cancer cell viability and proliferation.
ln Vivo
In 6-week-old female BALB/c nude mice with A549 cells, APTSTAT3-9R (8 mg/kg in 50 μL; intratumorally given every other day for a total of four injections) reduces tumor growth[1].
Intratumoral injection of APTSTAT3-9R exerts potent antitumor activity in both xenograft and allograft tumor models. It shows efficacy in vemurafenib-resistant melanoma when combined with anti-PD-1 immunotherapy. In pulmonary fibrosis models, APTSTAT3-9R formulated in lipid nanoparticles alleviates disease symptoms.
Enzyme Assay
Surface plasmon resonance (SPR) using immobilized recombinant STAT3 protein is used to measure binding affinity (Kd). For phosphorylation inhibition studies, purified STAT3 protein is incubated with the compound in the presence of active upstream kinases (e.g., JAK2). Phosphorylation is detected by Western blot using anti-p-STAT3 antibodies.
Cell Assay
Cancer cell lines (e.g., B16F1 melanoma, A549 lung cancer) are cultured and treated with APTSTAT3-9R (1-20 uM) for 24-72 hours. Cell viability is assessed by MTT or CellTiter-Glo. STAT3 phosphorylation and target gene expression (cyclin D1, survivin, Bcl-xL) are analyzed by Western blot and qPCR.
Animal Protocol
In mouse xenograft models (e.g., B16F1 melanoma), APTSTAT3-9R is administered via intratumoral injection (dose typically 5-20 mg/kg) daily or every other day. Tumor volume is measured every 2-3 days. Tumor tissue is harvested for analysis of p-STAT3 and downstream targets. For pulmonary fibrosis, intravenous administration of lipid nanoparticle formulations is used.
ADME/Pharmacokinetics
No detailed PK data. As a 33-amino acid peptide with a nona-arginine sequence (MW ~4948 g/mol), APTSTAT3-9R is expected to have rapid plasma degradation and short half-life without formulation. The 9R motif enables cellular penetration but does not confer oral bioavailability. Formulation in nanoparticles improves in vivo stability.
Toxicity/Toxicokinetics
In preclinical studies, no severe systemic toxicity or organ damage has been reported at therapeutic doses. Formulation in biomimetic lipid nanoparticles shows negligible systemic cytotoxicity. APTSTAT3-9R is non-cytotoxic to normal cells at concentrations that inhibit cancer cell growth.
References

[1]. A Specific STAT3-binding Peptide Exerts Antiproliferative Effects and Antitumor Activity by Inhibiting STAT3 Phosphorylation and Signaling. Cancer Res. 2014 Apr 15;74(8):2144-51.

Additional Infomation
APTSTAT3-9R is a research-grade peptide, not FDA-approved. It was identified through phage display of an "aptide" library. The aptide sequence binds STAT3 with high specificity. It has demonstrated preclinical proof-of-concept in cancer and fibrosis models. Strictly for research use.
These protocols are for reference only. InvivoChem does not independently validate these methods.
Physicochemical Properties
Molecular Formula
C223H330N80O51
Molecular Weight
4947.51
Sequence
His-Gly-Phe-Gln-Trp-Pro-Gly-Ser-Trp-Thr-Trp-Glu-Asn-Gly-Lys-Trp-Thr-Trp-Lys-Gly-Ala-Tyr-Gln-Phe-Leu-Lys-Gly-Gly-Gly-Gly-Ser-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-ArgHGFQWPGSWTWENGKWTWKGAYQFLKGGGGSRRRRRRRRR
SequenceShortening
HGFQWPGSWTWENGKWTWKGAYQFLKGGGGSRRRRRRRRR
Appearance
White to off-white solid powder
HS Tariff Code
2934.99.9001
Storage

Powder      -20°C    3 years

                     4°C     2 years

In solvent   -80°C    6 months

                  -20°C    1 month

Note: Please store this product in a sealed and protected environment (e.g. under nitrogen), avoid exposure to moisture and light.
Shipping Condition
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
Solubility Data
Solubility (In Vitro)
H2O: ≥ 50 mg/mL (~10.1 mM)
Solubility (In Vivo)
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.

Injection Formulations
(e.g. IP/IV/IM/SC)
Injection Formulation 1: DMSO : Tween 80: Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution → 50 μL Tween 80 → 850 μL Saline)
*Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution.
Injection Formulation 2: DMSO : PEG300 :Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO → 400 μLPEG300 → 50 μL Tween 80 → 450 μL Saline)
Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO → 900 μL Corn oil)
Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals).
View More

Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO → 900 μL (20% SBE-β-CD in saline)]
*Preparation of 20% SBE-β-CD in Saline (4°C,1 week): Dissolve 2 g SBE-β-CD in 10 mL saline to obtain a clear solution.
Injection Formulation 5: 2-Hydroxypropyl-β-cyclodextrin : Saline = 50 : 50 (i.e. 500 μL 2-Hydroxypropyl-β-cyclodextrin → 500 μL Saline)
Injection Formulation 6: DMSO : PEG300 : castor oil : Saline = 5 : 10 : 20 : 65 (i.e. 50 μL DMSO → 100 μLPEG300 → 200 μL castor oil → 650 μL Saline)
Injection Formulation 7: Ethanol : Cremophor : Saline = 10: 10 : 80 (i.e. 100 μL Ethanol → 100 μL Cremophor → 800 μL Saline)
Injection Formulation 8: Dissolve in Cremophor/Ethanol (50 : 50), then diluted by Saline
Injection Formulation 9: EtOH : Corn oil = 10 : 90 (i.e. 100 μL EtOH → 900 μL Corn oil)
Injection Formulation 10: EtOH : PEG300:Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL EtOH → 400 μLPEG300 → 50 μL Tween 80 → 450 μL Saline)


Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium)
Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose
Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals).
View More

Oral Formulation 3: Dissolved in PEG400
Oral Formulation 4: Suspend in 0.2% Carboxymethyl cellulose
Oral Formulation 5: Dissolve in 0.25% Tween 80 and 0.5% Carboxymethyl cellulose
Oral Formulation 6: Mixing with food powders


Note: Please be aware that the above formulations are for reference only. InvivoChem strongly recommends customers to read literature methods/protocols carefully before determining which formulation you should use for in vivo studies, as different compounds have different solubility properties and have to be formulated differently.

 (Please use freshly prepared in vivo formulations for optimal results.)
Preparing Stock Solutions 1 mg 5 mg 10 mg
1 mM 0.2021 mL 1.0106 mL 2.0212 mL
5 mM 0.0404 mL 0.2021 mL 0.4042 mL
10 mM 0.0202 mL 0.1011 mL 0.2021 mL

*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.

Calculator

Molarity Calculator allows you to calculate the mass, volume, and/or concentration required for a solution, as detailed below:

  • Calculate the Mass of a compound required to prepare a solution of known volume and concentration
  • Calculate the Volume of solution required to dissolve a compound of known mass to a desired concentration
  • Calculate the Concentration of a solution resulting from a known mass of compound in a specific volume
An example of molarity calculation using the molarity calculator is shown below:
What is the mass of compound required to make a 10 mM stock solution in 5 ml of DMSO given that the molecular weight of the compound is 350.26 g/mol?
  • Enter 350.26 in the Molecular Weight (MW) box
  • Enter 10 in the Concentration box and choose the correct unit (mM)
  • Enter 5 in the Volume box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 17.513 mg appears in the Mass box. In a similar way, you may calculate the volume and concentration.

Dilution Calculator allows you to calculate how to dilute a stock solution of known concentrations. For example, you may Enter C1, C2 & V2 to calculate V1, as detailed below:

What volume of a given 10 mM stock solution is required to make 25 ml of a 25 μM solution?
Using the equation C1V1 = C2V2, where C1=10 mM, C2=25 μM, V2=25 ml and V1 is the unknown:
  • Enter 10 into the Concentration (Start) box and choose the correct unit (mM)
  • Enter 25 into the Concentration (End) box and select the correct unit (mM)
  • Enter 25 into the Volume (End) box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 62.5 μL (0.1 ml) appears in the Volume (Start) box
g/mol

Molecular Weight Calculator allows you to calculate the molar mass and elemental composition of a compound, as detailed below:

Note: Chemical formula is case sensitive: C12H18N3O4  c12h18n3o4
Instructions to calculate molar mass (molecular weight) of a chemical compound:
  • To calculate molar mass of a chemical compound, please enter the chemical/molecular formula and click the “Calculate’ button.
Definitions of molecular mass, molecular weight, molar mass and molar weight:
  • Molecular mass (or molecular weight) is the mass of one molecule of a substance and is expressed in the unified atomic mass units (u). (1 u is equal to 1/12 the mass of one atom of carbon-12)
  • Molar mass (molar weight) is the mass of one mole of a substance and is expressed in g/mol.
/

Reconstitution Calculator allows you to calculate the volume of solvent required to reconstitute your vial.

  • Enter the mass of the reagent and the desired reconstitution concentration as well as the correct units
  • Click the “Calculate” button
  • The answer appears in the Volume (to add to vial) box
In vivo Formulation Calculator (Clear solution)
Step 1: Enter information below (Recommended: An additional animal to make allowance for loss during the experiment)
Step 2: Enter in vivo formulation (This is only a calculator, not the exact formulation for a specific product. Please contact us first if there is no in vivo formulation in the solubility section.)
+
+
+

Calculation results

Working concentration: mg/mL;

Method for preparing DMSO stock solution: mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.

Method for preparing in vivo formulation::Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O,mix and clarify.

(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
             (2) Be sure to add the solvent(s) in order.

Contact Us