| Size | Price | |
|---|---|---|
| 1mg | ||
| Other Sizes |
| Targets |
G3BP1 (as a control). The active Tat-peptide 168-189 targets G3BP1, a protein involved in Ras signaling and stress granule formation, and enhances axon growth. The “control” version is a scrambled or inactive sequence designed to lack the biological activity of the active peptide, allowing researchers to validate the specificity of observed effects.
|
|---|---|
| ln Vitro |
Neurite length is increased by 10 μM in isolated DRG cells and 20 μM in iMotor neurons by tat-peptide 168-189 TFA (10 μM, 20 μM; 24 hours) [1]. Total axon length from each neuron is increased by tat-peptide 168-189 TFA (10 μM; 3 days) [1].
The active Tat-peptide 168-189 promotes axon growth and increases the number of neurites per neuron. In contrast, the Tat-peptide control 168-189 TFA is a cell-permeable control peptide that does not promote axon growth, making it the ideal negative control. It contains the same Tat sequence for cell permeability but has a scrambled sequence in the functional region. |
| ln Vivo |
In vivo, the Tat-peptide control 168-189 TFA serves as a control to distinguish the specific in vivo effects of the active peptide. It can be administered to animal models to assess non-specific effects. The active peptide has been shown to affect neurite outgrowth, while the control is expected to have no such effect.
|
| Enzyme Assay |
Not applicable for the control peptide. Non-cell-based binding assays are not directly applicable, as the control serves as a negative comparator. The active peptide could be tested in a target binding assay using G3BP1 protein, with the control peptide showing no specific binding. SPR can be used to confirm the interaction.
|
| Cell Assay |
Primary neuron culture is established (e.g., from rat hippocampus). Neurons are seeded in 24-well plates coated with poly-D-lysine. After 2-3 days in vitro, neurons are treated with the control peptide (0.1-10 uM) alongside the active peptide for 48-72 h. Cells are fixed and stained for beta-tubulin III or MAP2 to visualize neurites. The number of neurites per cell and total neurite length are quantified by image analysis.
|
| Animal Protocol |
Injury or regeneration model in rodents: The peptide is administered intracerebrally or intrathecally. The control group receives the scrambled peptide at an equivalent dose. Axon growth or behavioral recovery is measured and compared between groups to assess the specificity of the active peptide's effects. The control peptide serves to rule out off-target peptide and Tat transduction domain effects.
|
| ADME/Pharmacokinetics |
As a synthetic peptide (MW 3672.10, TFA salt), the control has a short plasma half-life (minutes) due to proteolytic degradation. It is administered via intracerebroventricular or intrathecal injection for CNS studies. The TFA salt enhances solubility in aqueous buffers. The peptide should be stored as a powder at -20degC, sealed and away from moisture.
|
| Toxicity/Toxicokinetics |
Toxicity data for the control peptide are limited. It is a cell-permeable scrambled peptide that is generally non-toxic at the concentrations used (0.1-10 uM in vitro). As a research control, it is intended for research use only and not for human therapeutic applications. Standard safety precautions for handling peptides should be observed.
|
| References |
[1]. Sahoo PK, et al. Axonal G3BP1 stress granule protein limits axonal mRNA translation and nerve regeneration.
|
| Additional Infomation |
Tat-peptide control 168-189 TFA is a research-grade negative control peptide for the study of G3BP1-mediated neurite outgrowth. It is not a drug candidate and has no therapeutic indications. The sequence is DDSGTFYDQAVVSDMEEHLEEPYGNKKNNQNNN. For research use only.
|
| Molecular Formula |
C162H239N47O65S.C2HF3O2
|
|---|---|
| Related CAS # |
Tat-peptide control 168-189
|
| Appearance |
White to off-white solid powder
|
| HS Tariff Code |
2934.99.9001
|
| Storage |
Powder -20°C 3 years 4°C 2 years In solvent -80°C 6 months -20°C 1 month Note: Please store this product in a sealed and protected environment (e.g. under nitrogen), avoid exposure to moisture and light. |
| Shipping Condition |
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
|
| Solubility (In Vitro) |
May dissolve in DMSO (in most cases), if not, try other solvents such as H2O, Ethanol, or DMF with a minute amount of products to avoid loss of samples
|
|---|---|
| Solubility (In Vivo) |
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.
Injection Formulations
Injection Formulation 1: DMSO : Tween 80： Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution → 50 μL Tween 80 → 850 μL Saline)(e.g. IP/IV/IM/SC) *Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution. Injection Formulation 2: DMSO : PEG300 ：Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO → 400 μLPEG300 → 50 μL Tween 80 → 450 μL Saline) Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO → 900 μL Corn oil) Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals). View More
Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO → 900 μL (20% SBE-β-CD in saline)] Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium) Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals). View More
Oral Formulation 3: Dissolved in PEG400 (Please use freshly prepared in vivo formulations for optimal results.) |
Calculation results
Working concentration： mg/mL；
Method for preparing DMSO stock solution： mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.
Method for preparing in vivo formulation:：Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O，mix and clarify.
(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
(2) Be sure to add the solvent(s) in order.
Products are for research use only; We do not sell to patients
Copyright 2020 InvivoChem LLC | All Rights Reserved
