yingweiwo

Vosoritide acetate (BMN 111 acetate)

Alias: Vosoritide; Voxzogo; BMN-111 acetate; 1480724-61-5; BMN 111 acetate;
Cat No.:V76353 Purity: ≥98%
Vosoritide (BMN 111) acetate is a natriuretic peptide receptor 2 (NPR2) agonist that acts on chondrocyte proliferation and differentiation to promote bone growth.
Vosoritide acetate (BMN 111 acetate)
Vosoritide acetate (BMN 111 acetate) Chemical Structure Product category: FGFR
This product is for research use only, not for human use. We do not sell to patients.
Size Price Stock Qty
1mg
5mg
10mg
25mg
100mg
1g
Other Sizes

Other Forms of Vosoritide acetate (BMN 111 acetate):

  • Rolzavosoritide
  • Vosoritide (BMN-111; Voxzogo)
Official Supplier of:
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Top Publications Citing lnvivochem Products
Purity & Quality Control Documentation

Purity: =99.01%

Purity: =99.62%

Product Description
Vosoritide (BMN 111) acetate is a natriuretic peptide receptor 2 (NPR2) agonist that acts on chondrocyte proliferation and differentiation to promote bone growth. Vosoritide, commercially known as VOXZOGO®, is a synthetic analog of human C-type natriuretic peptide (CNP) developed by BioMarin Pharmaceutical for treating achondroplasia. This condition arises from a gain-of-function mutation in the fibroblast growth factor receptor 3 gene (FGFR3), which suppresses bone growth. Vosoritide promotes chondrogenesis by binding to natriuretic peptide receptor B (NPR-B), thereby inhibiting the downstream signaling pathways triggered by the overactive FGFR3 gene. In August 2021, the European Union approved vosoritide for patients aged two years and older with open epiphyses, requiring confirmation of achondroplasia through appropriate genetic testing. The drug is currently under regulatory review in the United States for the same indication, with clinical trials ongoing in multiple other countries. This article outlines the key developmental milestones that led to this initial approval for treating achondroplasia in this specific patient population.
Vosoritide is an analog of C-type natriuretic peptide that stimulates bone growth, thereby counteracting growth suppression in children with achondroplasia. Following daily administration, urinary cyclic guanosine monophosphate (cGMP) and serum collagen type X marker (CXM) are both elevated, serving as biomarkers for enhanced endochondral bone formation. cGMP levels reflect NPR-B receptor engagement, while CXM indicates bone metabolic activity. Although generally well tolerated, transient episodes of hypotension have been reported in clinical studies. Patients with preexisting cardiovascular disease or those receiving antihypertensive medications were excluded from clinical trials. The risk of hypotension may be minimized by ensuring adequate food and fluid intake prior to vosoritide administration. Use of vosoritide should also be avoided in patients with an estimated glomerular filtration rate (eGFR) below 60 mL/min/1.73 m², as data on the impact of renal impairment on its pharmacokinetics are lacking.
Achondroplasia is a congenital disorder caused by a missense mutation in the fibroblast growth factor receptor 3 (FGFR3) gene, which results in a gain-of-function that negatively regulates endochondral bone formation. FGFR3 is expressed during both embryonic and postnatal development but plays distinct roles at each stage. During early development, FGFR3 signaling promotes chondrocyte proliferation (i.e., bone growth), whereas postnatal skeletal elongation is actually suppressed by FGFR3. Consequently, the pathological activation of FGFR3 observed in achondroplasia leads to impaired pre-pubertal skeletal growth. Vosoritide is an analog of C-type natriuretic peptide (CNP), a signaling molecule that is primarily responsible for stimulating chondrocyte activity and long bone elongation. When CNP (or vosoritide) binds to its cognate receptor, NPR-B, it initiates a signaling cascade that ultimately inhibits the MAPK/ERK pathway through suppression of RAF-1, thereby promoting chondrocyte proliferation and differentiation. This activity antagonizes the downstream signaling triggered by FGFR3, counteracting its inhibitory effects on bone growth.
Vosoritide acetate (BMN 111 acetate) is a natriuretic peptide receptor 2 (NPR2) agonist. It is a peptide drug designed based on C-type natriuretic peptide analogues. Vosoritide acts on the proliferation and differentiation of chondrocytes to promote bone growth. It has been used to treat achondroplasia and other growth disorders.
Biological Activity I Assay Protocols (From Reference)
Targets
Natriuretic peptide receptor 2 (NPR2, also known as guanylyl cyclase B). Vosoritide (BMN-111) acts as an agonist of NPR2, stimulating the production of cyclic GMP (cGMP). [2]
The mechanism involves antagonizing fibroblast growth factor receptor 3 (FGFR3) downstream signaling by inhibiting the mitogen-activated protein kinase (MAPK) pathway, specifically reducing the phosphorylation of ERK1/2. [2, 3]
Vosoritide acetate targets the natriuretic peptide receptor 2 (NPR2). By activating NPR2, it promotes the generation of cGMP. It also antagonizes the FGFR3 signaling pathway, which inhibits bone growth. The mechanism involves antagonizing fibroblast growth factor receptor 3 (FGFR3) downstream signaling by inhibiting the mitogen-activated protein kinase (MAPK) pathway.
ln Vitro
In human growth plate chondrocytes from individuals with achondroplasia (ACH) harboring the FGFR3 c.1138G>A (p.Gly380Arg) mutation, treatment with BMN-111 (10⁻⁵ M) partially prevented the fibroblast growth factor (FGF)-mediated increase in ERK1/2 phosphorylation. This was assessed by immunoblotting of cell lysates using a phospho-ERK1/2 antibody. In contrast, FGF-mediated STAT3 phosphorylation was not decreased by BMN-111 in these cells. [3]
In chondrocytes, vosoritide (0.1 μM; 1 hour) acetate decreases NPR2 phosphorylation [2]. In cultured Fgfr3Y367C/+ femurs, voyoritide (0.1 μM; 6 days) acetate enhances chondrocyte differentiation and augments proliferative growth plate area [2]. In ACH growth plate chondrocytes, vosoritide (10 μM; overnight) acetate decreases ERK1/2 activity [3].
In vitro, Vosoritide acetate acts on the proliferation and differentiation of chondrocytes to promote bone growth. It is an NPR2 agonist. It promotes chondrogenesis by binding to natriuretic peptide receptor B (NPR-B), thereby inhibiting the downstream signaling pathways triggered by the overactive FGFR3 gene.
ln Vivo
In the Fgfr3Y367C/+ mouse model of achondroplasia, subcutaneous administration of BMN-111 led to significant recovery of bone growth. [3]
Ex Vivo (Femur Explants): In femurs isolated from E16.5 Fgfr3Y367C/+ mouse embryos, co-incubation with BMN-111 (10⁻⁶ M to 10⁻¹⁰ M) for 6 days resulted in a concentration-dependent increase in femur length. The maximum effect was observed at 10⁻⁶ M. Histological analysis showed a concentration-dependent expansion of the proliferative and hypertrophic zones, with larger and spherical hypertrophic chondrocytes, and an increased hypertrophic zone area as shown by type X collagen staining. [3]
In Vivo (10-Day Treatment): Fgfr3Y367C/+ mice treated once daily with subcutaneous BMN-111 (800 μg/kg) for 10 days showed significant growth improvements, including a 5.2% increase in femur length, 5.3% increase in nasoanal length, 6.6% increase in tibia length, 4.8% increase in anterior-posterior skull diameter, and 8.0% increase in tail length compared to vehicle-treated controls (p < 0.05). Histological analysis of the distal femur revealed dose-dependent modifications, including expansion of the prehypertrophic and hypertrophic zones, with larger and more spherical hypertrophic cells. [3]
In Vivo (20-Day Treatment): Extended treatment with BMN-111 (800 μg/kg once daily) for 20 days resulted in further phenotypic improvements, including flattening of the skull, elongation of the snout, improvement of the anterior crossbite, longer and straightened tibias and femurs, and longer tails. Histological analysis showed rescue of the growth plate height and architecture, with proliferative and hypertrophic chondrocytes organized in columns. [3]
In mice with Fgfr3 gain-of-function mutations, vosoritide (subcutaneous injection; 800 μg/kg; once daily; 20 days) acetate therapy improves skeletal metrics [3].
In vivo, Vosoritide acetate has been used to treat achondroplasia and other growth disorders. It promotes bone growth by activating NPR2 and antagonizing FGFR3 signaling. It is currently used to treat growth disorders such as achondroplasia. It has been evaluated in a Phase 3 clinical trial (NCT03197766) for efficacy and safety in children with achondroplasia.
Enzyme Assay
Non-cellular receptor binding assays for Vosoritide acetate would involve measuring its binding affinity to NPR2. These assays can be performed using surface plasmon resonance (SPR) or radioligand binding techniques with purified NPR2 protein.
Cell Assay
Western Blot Analysis (Human ACH Chondrocytes): Human control and ACH growth plate chondrocytes (harboring the FGFR3 p.Gly380Arg mutation) were isolated and cultured. Cells were pretreated with BMN-111 (10⁻⁵ M) and then co-incubated with FGF18 (100 ng/mL). Cell lysates were subjected to SDS-PAGE and hybridized overnight with a phosphorylated-ERK1/2 antibody. BMN-111 pretreatment partially prevented the FGF-mediated increase in ERK1/2 phosphorylation (n=6). STAT3 phosphorylation was assessed similarly using a phospho-STAT3 antibody, which was not decreased by BMN-111 co-incubation. [3]
Western Blot Analysis[2]
Cell Types: Chondrocyte cultures
Tested Concentrations: 0.1 μM
Incubation Duration: 1 hour
Experimental Results: Led to reduction in NPR2 phosphorylation.

Western Blot Analysis[3]
Cell Types: Chondrocyte
Tested Concentrations: 10 μM
Incubation Duration: Overnight
Experimental Results: Prevented FGF-mediated increase in ERK1/2 phosphorylation.
In vitro cellular assays for Vosoritide acetate are performed using chondrocytes. Cells are treated with the compound, and the activation of NPR2 is assessed by measuring cGMP production. The compound's effects on chondrocyte proliferation and differentiation are also evaluated.
Animal Protocol
Ex Vivo Femur Culture: Femurs were dissected from E16.5 Fgfr3Y367C/+ mouse embryos and cultured in DMEM with antibiotics and 0.2% BSA for 6 days. The culture medium was supplemented with BMN-111 at concentrations ranging from 10⁻⁶ M to 10⁻¹⁰ M, or vehicle (control). The left femur was treated, and the right femur served as a control. Bone length was measured at day 0 (D0) and day 6 (D6). [3]
In Vivo Mouse Study (10-Day): Fgfr3Y367C/+ and wild-type mice (7 days old) received once-daily subcutaneous administrations of BMN-111 (240 μg/kg or 800 μg/kg) or vehicle (0.03 mol/L acetic acid buffer solution, pH 4.0, containing 1% [w/v] benzyl alcohol and 10% [w/v] sucrose) for 10 days. Dosing occurred approximately 2 hours prior to the dark cycle. Body length, tail length, and various bone segments were measured. [3]
In Vivo Mouse Study (20-Day): Fgfr3Y367C/+ and wild-type mice (7 days old) received once-daily subcutaneous administrations of BMN-111 (800 μg/kg) or vehicle for 20 days. Skeletal changes were assessed by X-ray and histological analysis. [3]
Animal/Disease Models: Fgfr3Y367C/+ mice[3]
Doses: 800 μg/kg
Route of Administration: subcutaneous (sc) injection; 800 μg/kg; one time/day; 20 days
Experimental Results: Observed phenotypic changes including flattening of the skull, elongation of the snout, improvement of the anterior crossbite, larger paws and digits, and longer and straightened tibias and femurs.
In vivo animal experiments for Vosoritide acetate would be conducted in animal models of achondroplasia or other growth disorders. The compound would be administered via injection, and endpoints would include bone growth, histomorphometry, and biochemical markers of bone turnover.
ADME/Pharmacokinetics
Absorption
In patients receiving daily subcutaneous injections of vosoritide 15 mcg/kg, the mean Cmax ranged from 4.71-7.18 ng/mL and the mean AUC0-t ranged from 161-290 ng-min/mL. The median Tmax following subcutaneous injection was approximately 15 minutes.

Volume of Distribution
The mean apparent volume of distribution following the subcutaneous administration of 15 mcg/kg of vosoritide ranged from 2880 to 3020 mL/kg.

Clearance
The mean apparent clearance following the subcutaneous administration of 15 mcg/kg of vosoritide ranged from 79.4 to 104 mL/min/kg.

Metabolism / Metabolites
As with other therapeutic proteins, vosoritide is likely metabolized via catabolic pathways into smaller peptides and amino acids.

Biological Half-Life
The mean half-life following the subcutaneous administration of 15 mcg/kg of vosoritide ranged from 21.0 to 27.9 minutes.

BMN-111 is a 39-amino acid CNP analog designed to be resistant to neutral endopeptidase (NEP) digestion, which extends its plasma half-life compared to native CNP. This property allows for once-daily subcutaneous administration. [3]
Vosoritide acetate has a molecular formula of C176H290N56O51S3. Its CAS number is 1480724-61-5. It is a peptide drug. It is metabolized by neutral endopeptidase (NEP), one of the main clearance pathways responsible for the short half-life of these peptides.
Toxicity/Toxicokinetics
In Fgfr3Y367C/+ mice treated with BMN-111 (800 μg/kg once daily) for 20 days, the tail was longer and had some kinks, suggesting a potential overdose effect, as similarly seen in mice overexpressing CNP. [3]

Hepatotoxicity
In the registration studies submitted in support of approval of vosoritide, “overall, there were no clinically meaningful changes in any laboratory parameter in the clinical program.” Serum ALT levels rose to above the upper limit of normal (ULN) in 22% of vosoritide treated participants vs 18% of controls, but there were no increases above 5 times ULN or elevations accompanied by jaundice or symptoms. Alkaline phosphatase elevations arose in at least 17% of treated patients vs 7% of controls, but the abnormalities were possibly a result of bone growth rather than liver or biliary injury. In the initial clinical trial and in subsequent more widespread use of vosoritide, there have been no reports of clinically apparent liver injury or jaundice.
Toxicological data for Vosoritide acetate are not detailed in the search results. As a therapeutic peptide, its safety profile would have been evaluated in preclinical and clinical studies. A secondary pharmacology study evaluating potential off-target effects revealed that it inhibits 8 receptors/channels by more than 50%.
References

[1]. Vosoritide: First Approval. Drugs. 2021 Nov;81(17):2057-2062.

[2]. Phosphatase inhibition by LB-100 enhances BMN-111 stimulation of bone growth. JCI Insight. 2021 May 10;6(9):e141426.

[3]. Evaluation of the therapeutic potential of a CNP analog in a Fgfr3 mouse model recapitulating achondroplasia. Am J Hum Genet. 2012 Dec 7;91(6):1108-14.

Additional Infomation
Achondroplasia is an autosomal dominant genetic disorder and the most common cause of dwarfism in humans. It is caused by a gain-of-function missense mutation in the FGFR3 gene, which leads to a marked suppression of bone growth, affecting both length and volume. Treatment options for achondroplasia include surgical procedures and pharmacological therapies, with the latter encompassing C-type natriuretic peptide (CNP) analogs.Endogenous CNP, first characterized in 1998, promotes chondrocyte activity and long bone elongation primarily through its action on the NPR-B receptor, positioning it as a compelling target for treating conditions such as achondroplasia. However, the therapeutic utility of native CNP is limited by its extremely short half-life of 2 to 3 minutes, attributed to rapid degradation by endopeptidases. The development of a peptidase-resistant formulation has enabled its use as a viable treatment option.Vosoritide is a CNP analog engineered with proline-glycine residues at its N-terminus to confer resistance to neutral endopeptidase. It was approved under the brand name Voxzogo (BioMarin Pharmaceutical Inc.) in the European Union in August 2021 and in the United States in November 2021, marking the first pharmacological intervention approved for achondroplasia in both regions.Vosoritide is a modified recombinant C-type natriuretic peptide analog used to promote linear growth in children and adolescents with achondroplasia who still have open epiphyses. It is administered via daily subcutaneous injections. Notably, its use has not been associated with elevations in serum aminotransferase levels or with cases of clinically apparent liver injury, reflecting its favorable safety profile as a biologic analog of C-type natriuretic peptide—a potent stimulator of endochondral ossification.
Vosoritide (BMN-111) is a C-type natriuretic peptide (CNP) analog developed as a therapeutic for achondroplasia (ACH), the most common form of dwarfism, which is caused by gain-of-function mutations in FGFR3. [2, 3]
The mechanism of action involves antagonizing FGFR3 downstream signaling by inhibiting the MAPK pathway, specifically reducing ERK1/2 phosphorylation. This action counteracts the negative regulation of bone growth by FGFR3. [3]
In the Fgfr3Y367C/+ mouse model that recapitulates human ACH, BMN-111 treatment led to a significant recovery of bone growth, improvement in dwarfism-related clinical features (flattening of the skull, reduced crossbite, straightening of tibias and femurs), and correction of growth plate defects. [3]
Phase 2 and 3 clinical trials have demonstrated that vosoritide results in a sustained increase in annualized growth velocity in children with achondroplasia. [2]
Mechanism of Action: Achondroplasia is a congenital disorder caused by a missense mutation in the fibroblast growth factor receptor 3 (FGFR3) gene, which results in a gain-of-function that negatively regulates endochondral bone formation. FGFR3 is expressed during both embryonic and postnatal development but plays distinct roles at each stage. During early development, FGFR3 signaling promotes chondrocyte proliferation (i.e., bone growth), whereas postnatal skeletal elongation is actually suppressed by FGFR3. Consequently, the pathological activation of FGFR3 observed in achondroplasia leads to impaired pre-pubertal skeletal growth.Vosoritide is an analog of C-type natriuretic peptide (CNP), a signaling molecule that is primarily responsible for stimulating chondrocyte activity and long bone elongation. When CNP (or vosoritide) binds to its cognate receptor, NPR-B, it initiates a signaling cascade that ultimately inhibits the MAPK/ERK pathway through suppression of RAF-1, thereby promoting chondrocyte proliferation and differentiation. This activity antagonizes the downstream signaling triggered by FGFR3, counteracting its inhibitory effects on bone growth.
Vosoritide acetate (BMN 111 acetate) is an NPR2 agonist. It acts on chondrocytes to promote bone growth and has been used to treat achondroplasia and other growth disorders. It is a peptide drug. It is approved for clinical use.
These protocols are for reference only. InvivoChem does not independently validate these methods.
Physicochemical Properties
Molecular Formula
C176H290N56O51S3.C2H4O2
Molecular Weight
4162.78
Related CAS #
Vosoritide;1480724-61-5
PubChem CID
176451811
Sequence
Pro-Gly-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge:Cys23-Cys39)
SequenceShortening
PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys23-Cys39)
Appearance
White to off-white solid powder
Hydrogen Bond Donor Count
63
Hydrogen Bond Acceptor Count
67
Rotatable Bond Count
112
Heavy Atom Count
289
Complexity
9550
Defined Atom Stereocenter Count
32
SMILES
CC[C@H](C)[C@H]1C(=O)NCC(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CSSC[C@@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N1)CCCNC(=N)N)CC(=O)O)CC(C)C)CCCCN)CC(C)C)CC2=CC=CC=C2)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CC3=CC=C(C=C3)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC([C@H](C)NC(=O)[C@H](CC(=O)N)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CC5=CN=CN5)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)CNC(=O)[C@@H]6CCCN6)O)C(=O)O)CC(C)C)CO)CCSC)O.CC(=O)O
InChi Key
NHHKBNZICKNNGT-AXJKEOMPSA-N
InChi Code
InChI=1S/C175H290N56O51S3.C2H4O2/c1-14-94(10)141-169(277)200-84-138(245)229-171(279)170(278)219-112(54-65-283-13)157(265)227-123(85-232)150(258)199-81-133(240)205-113(66-90(2)3)148(256)197-83-137(244)209-126(173(281)282)88-285-284-87-125(167(275)222-117(70-97-34-16-15-17-35-97)149(257)198-80-135(242)206-114(67-91(4)5)160(268)215-107(41-23-29-60-181)153(261)221-116(69-93(8)9)162(270)224-121(75-140(248)249)165(273)217-109(158(266)230-141)44-32-63-192-175(187)188)208-136(243)82-196-147(255)104(38-20-26-57-178)213-166(274)124(86-233)228-161(269)115(68-92(6)7)207-134(241)79-195-145(253)102(36-18-24-55-176)211-151(259)105(39-21-27-58-179)216-164(272)120(74-130(184)237)220-142(250)95(11)202-131(238)77-194-146(254)103(37-19-25-56-177)212-163(271)118(71-98-46-48-100(234)49-47-98)223-154(262)106(40-22-28-59-180)214-152(260)108(43-31-62-191-174(185)186)210-143(251)96(12)203-159(267)119(73-129(183)236)225-168(276)127-45-33-64-231(127)172(280)122(72-99-76-189-89-201-99)226-156(264)111(51-53-139(246)247)218-155(263)110(50-52-128(182)235)204-132(239)78-193-144(252)101-42-30-61-190-101;1-2(3)4/h15-17,34-35,46-49,76,89-96,101-127,141,143,171,190,210,232-234,251,279H,14,18-33,36-45,50-75,77-88,176-181H2,1-13H3,(H2,182,235)(H2,183,236)(H2,184,237)(H,189,201)(H,193,252)(H,194,254)(H,195,253)(H,196,255)(H,197,256)(H,198,257)(H,199,258)(H,200,277)(H,202,238)(H,203,267)(H,204,239)(H,205,240)(H,206,242)(H,207,241)(H,208,243)(H,209,244)(H,211,259)(H,212,271)(H,213,274)(H,214,260)(H,215,268)(H,216,272)(H,217,273)(H,218,263)(H,219,278)(H,220,250)(H,221,261)(H,222,275)(H,223,262)(H,224,270)(H,225,276)(H,226,264)(H,227,265)(H,228,269)(H,229,245)(H,230,266)(H,246,247)(H,248,249)(H,281,282)(H4,185,186,191)(H4,187,188,192);1H3,(H,3,4)/t94-,95-,96-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,141-,143?,171-;/m0./s1
Chemical Name
acetic acid;(4R,10S,16S,19S,22S,28S,31S,34S,37S,40S,43S,49S,52R)-52-[[2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-6-amino-2-[[(2S)-6-amino-2-[[(2S)-4-amino-2-[[(2S)-2-[[2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-5-amino-5-oxo-2-[[2-[[(2S)-pyrrolidine-2-carbonyl]amino]acetyl]amino]pentanoyl]amino]-4-carboxybutanoyl]amino]-3-(1H-imidazol-5-yl)propanoyl]pyrrolidine-2-carbonyl]amino]-4-oxobutanoyl]amino]-1-hydroxypropyl]amino]-5-carbamimidamidopentanoyl]amino]hexanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]hexanoyl]amino]acetyl]amino]propanoyl]amino]-4-oxobutanoyl]amino]hexanoyl]amino]hexanoyl]amino]acetyl]amino]-4-methylpentanoyl]amino]-3-hydroxypropanoyl]amino]hexanoyl]amino]acetyl]amino]-40-(4-aminobutyl)-49-benzyl-28-[(2S)-butan-2-yl]-31-(3-carbamimidamidopropyl)-34-(carboxymethyl)-22-hydroxy-16-(hydroxymethyl)-10,37,43-tris(2-methylpropyl)-19-(2-methylsulfanylethyl)-6,9,12,15,18,21,24,27,30,33,36,39,42,45,48,51-hexadecaoxo-1,2-dithia-5,8,11,14,17,20,23,26,29,32,35,38,41,44,47,50-hexadecazacyclotripentacontane-4-carboxylic acid
Synonyms
Vosoritide; Voxzogo; BMN-111 acetate; 1480724-61-5; BMN 111 acetate;
HS Tariff Code
2934.99.9001
Storage

Powder      -20°C    3 years

                     4°C     2 years

In solvent   -80°C    6 months

                  -20°C    1 month

Note: Please store this product in a sealed and protected environment (e.g. under nitrogen), avoid exposure to moisture and light.
Shipping Condition
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
Solubility Data
Solubility (In Vitro)
H2O :≥ 100 mg/mL (~24.02 mM)
Solubility (In Vivo)
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.

Injection Formulations
(e.g. IP/IV/IM/SC)
Injection Formulation 1: DMSO : Tween 80: Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution 50 μL Tween 80 850 μL Saline)
*Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution.
Injection Formulation 2: DMSO : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO 400 μLPEG300 50 μL Tween 80 450 μL Saline)
Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO 900 μL Corn oil)
Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals).
View More

Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO 900 μL (20% SBE-β-CD in saline)]
*Preparation of 20% SBE-β-CD in Saline (4°C,1 week): Dissolve 2 g SBE-β-CD in 10 mL saline to obtain a clear solution.
Injection Formulation 5: 2-Hydroxypropyl-β-cyclodextrin : Saline = 50 : 50 (i.e. 500 μL 2-Hydroxypropyl-β-cyclodextrin 500 μL Saline)
Injection Formulation 6: DMSO : PEG300 : castor oil : Saline = 5 : 10 : 20 : 65 (i.e. 50 μL DMSO 100 μLPEG300 200 μL castor oil 650 μL Saline)
Injection Formulation 7: Ethanol : Cremophor : Saline = 10: 10 : 80 (i.e. 100 μL Ethanol 100 μL Cremophor 800 μL Saline)
Injection Formulation 8: Dissolve in Cremophor/Ethanol (50 : 50), then diluted by Saline
Injection Formulation 9: EtOH : Corn oil = 10 : 90 (i.e. 100 μL EtOH 900 μL Corn oil)
Injection Formulation 10: EtOH : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL EtOH 400 μLPEG300 50 μL Tween 80 450 μL Saline)


Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium)
Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose
Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals).
View More

Oral Formulation 3: Dissolved in PEG400
Oral Formulation 4: Suspend in 0.2% Carboxymethyl cellulose
Oral Formulation 5: Dissolve in 0.25% Tween 80 and 0.5% Carboxymethyl cellulose
Oral Formulation 6: Mixing with food powders


Note: Please be aware that the above formulations are for reference only. InvivoChem strongly recommends customers to read literature methods/protocols carefully before determining which formulation you should use for in vivo studies, as different compounds have different solubility properties and have to be formulated differently.

 (Please use freshly prepared in vivo formulations for optimal results.)
Preparing Stock Solutions 1 mg 5 mg 10 mg
1 mM 0.2402 mL 1.2011 mL 2.4022 mL
5 mM 0.0480 mL 0.2402 mL 0.4804 mL
10 mM 0.0240 mL 0.1201 mL 0.2402 mL

*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.

Calculator

Molarity Calculator allows you to calculate the mass, volume, and/or concentration required for a solution, as detailed below:

  • Calculate the Mass of a compound required to prepare a solution of known volume and concentration
  • Calculate the Volume of solution required to dissolve a compound of known mass to a desired concentration
  • Calculate the Concentration of a solution resulting from a known mass of compound in a specific volume
An example of molarity calculation using the molarity calculator is shown below:
What is the mass of compound required to make a 10 mM stock solution in 5 ml of DMSO given that the molecular weight of the compound is 350.26 g/mol?
  • Enter 350.26 in the Molecular Weight (MW) box
  • Enter 10 in the Concentration box and choose the correct unit (mM)
  • Enter 5 in the Volume box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 17.513 mg appears in the Mass box. In a similar way, you may calculate the volume and concentration.

Dilution Calculator allows you to calculate how to dilute a stock solution of known concentrations. For example, you may Enter C1, C2 & V2 to calculate V1, as detailed below:

What volume of a given 10 mM stock solution is required to make 25 ml of a 25 μM solution?
Using the equation C1V1 = C2V2, where C1=10 mM, C2=25 μM, V2=25 ml and V1 is the unknown:
  • Enter 10 into the Concentration (Start) box and choose the correct unit (mM)
  • Enter 25 into the Concentration (End) box and select the correct unit (mM)
  • Enter 25 into the Volume (End) box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 62.5 μL (0.1 ml) appears in the Volume (Start) box
g/mol

Molecular Weight Calculator allows you to calculate the molar mass and elemental composition of a compound, as detailed below:

Note: Chemical formula is case sensitive: C12H18N3O4  c12h18n3o4
Instructions to calculate molar mass (molecular weight) of a chemical compound:
  • To calculate molar mass of a chemical compound, please enter the chemical/molecular formula and click the “Calculate’ button.
Definitions of molecular mass, molecular weight, molar mass and molar weight:
  • Molecular mass (or molecular weight) is the mass of one molecule of a substance and is expressed in the unified atomic mass units (u). (1 u is equal to 1/12 the mass of one atom of carbon-12)
  • Molar mass (molar weight) is the mass of one mole of a substance and is expressed in g/mol.
/

Reconstitution Calculator allows you to calculate the volume of solvent required to reconstitute your vial.

  • Enter the mass of the reagent and the desired reconstitution concentration as well as the correct units
  • Click the “Calculate” button
  • The answer appears in the Volume (to add to vial) box
In vivo Formulation Calculator (Clear solution)
Step 1: Enter information below (Recommended: An additional animal to make allowance for loss during the experiment)
Step 2: Enter in vivo formulation (This is only a calculator, not the exact formulation for a specific product. Please contact us first if there is no in vivo formulation in the solubility section.)
+
+
+

Calculation results

Working concentration mg/mL;

Method for preparing DMSO stock solution mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.

Method for preparing in vivo formulation:Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O,mix and clarify.

(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
             (2) Be sure to add the solvent(s) in order.

Clinical Trial Information
A Study of Vosoritide Versus Placebo in Children With Hypochondroplasia Aged 0 to < 36 Months
CTID: NCT07126262
Phase: Phase 2
Status: Recruiting
Date: 2026-03-13
An Extension Study to Evaluate the Efficacy and Safety of BMN 111 in Children With Achondroplasia
CTID: NCT03424018
Phase: Phase 3
Status: Active, not recruiting
Date: 2026-03-13
A Clinical Trial to Evaluate Safety of Vosoritide in At-risk Infants With Achondroplasia
CTID: NCT04554940
Phase: Phase 2
Status: Active, not recruiting
Date: 2026-03-13
A Phase 2 Study of Vosoritide in Children With Idiopathic Short Stature
CTID: NCT06382155
Phase: Phase 2
Status: Recruiting
Date: 2026-03-13
A Study to Evaluate Long-Term Safety, Tolerability, & Efficacy of BMN 111 in Children With Achondroplasia (ACH)
CTID: NCT02724228
Phase: Phase 2
Status: Active, not recruiting
Date: 2026-03-13
Safety and Efficacy of Voxzogo for Growth Deficits in MPS IVA and VI
CTID: NCT05845749
Phase: Phase 1/Phase 2
Status: Active, not recruiting
Date: 2026-03-10
A Phase 2/3 Study to Evaluate the Efficacy and Safety of BMN 333 Versus Vosoritide in Children With Achondroplasia
CTID: NCT07441876
Phase: Phase 2/Phase 3
Status: Not yet recruiting
Date: 2026-03-02
A Basket Study of Vosoritide in Children With Turner Syndrome, Short Stature Homeobox-Containing Gene Deficiency, and Noonan Syndrome With Inadequate Growth During or After Human Growth Hormone Treatment
CTID: NCT06668805
Phase: Phase 2
Status: Recruiting
Date: 2026-02-27
Interventional Study of Vosoritide for the Treatment of Children With Hypochondroplasia
CTID: NCT06455059
Phase: Phase 3
Status: Active, not recruiting
Date: 2026-01-20
Long-Term Extension Study of Vosoritide to Treat Children With Hypochondroplasia
CTID: NCT07073014
Phase: Phase 3
Status: Enrolling by invitation
Date: 2025-07-18
Vosoritide for Short Stature in Turner Syndrome
CTID: NCT05849389
Phase: Phase 2
Status: Recruiting
Date: 2024-06-24
A Clinical Trial to Evaluate the Safety and Efficacy of BMN 111 in Infants and Young Children With Achondroplasia
CTID: NCT03583697
Phase: Phase 2
Status: Completed
Date: 2024-06-13
Vosoritide for Selected Genetic Causes of Short Stature
CTID: NCT04219007
Phase: Phase 2
Status: Active, not recruiting
Date: 2024-02-06
A Study to Evaluate the Efficacy and Safety of BMN 111 in Children With Achondroplasia
CTID: NCT03197766
Phase: Phase 3
Status: Completed
Date: 2022-03-02
A Phase 2 Study of BMN 111 to Evaluate Safety, Tolerability, and Efficacy in Children With Achondroplasia
CTID: NCT02055157
Phase: Phase 2
Status: Completed
Date: 2021-01-15
A randomized, controlled, open-label clinical trial with an open-label extension to investigate the safety of BMN 111 in infants and young children with achondroplasia at risk of requiring cervicomedullary decompression surgery
EudraCT: 2020-001055-40
Phase: Phase 2
Status: GB - no longer in EU/EEA
Date: 2020-07-29
A Phase 2 Open-Label Long-Term Extension Study to Evaluate the Safety
EudraCT: 2018-004364-66
Phase: Phase 2
Status: GB - no longer in EU/EEA
Date: 2019-10-22
A Phase 3, Open-Label Long-Term Extension Study to Evaluate the Safety and Efficacy of BMN 111 in Children with Achondroplasia
EudraCT: 2017-002404-28
Phase: Phase 3
Status: GB - no longer in EU/EEA, Ongoing, Trial now transitioned
Date: 2018-10-12
A Phase 2 Randomized, Double-Blind, Placebo-Controlled Clinical Trial to Evaluate the Safety and Efficacy of BMN 111 in Infants and Young Children with Achondroplasia, Age 0 to < 60 Months
EudraCT: 2016-003826-18
Phase: Phase 2
Status: GB - no longer in EU/EEA
Date: 2018-09-12
A Phase 3 Randomized, Double-Blind, Placebo-Controlled, Multicenter Study to Evaluate the Efficacy and Safety of BMN 111 in Children with Achondroplasia.
EudraCT: 2015-003836-11
Phase: Phase 3
Status: Completed
Date: 2017-01-20
Interventional Study of Vosoritide for the Treatment of Children With Hypochondroplasia
CTID: jRCT2051240179
Status: Not Recruiting
Date: 2024-11-08
Contact Us