yingweiwo

Pramlintide acetate

Alias: 187887-46-3; Triproamylin acetate; UNII-JS41L76X7I; Tripro-amylin acetate; Pramlintide acetate anhydrous;
Cat No.:V74548 Purity: ≥98%
Pramlintide acetate is a human amylin analog.
Pramlintide acetate
Pramlintide acetate Chemical Structure CAS No.: 187887-46-3
Product category: Others 12
This product is for research use only, not for human use. We do not sell to patients.
Size Price Stock Qty
1mg
5mg
10mg
50mg
Other Sizes

Other Forms of Pramlintide acetate:

  • Pramlintide
Official Supplier of:
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Top Publications Citing lnvivochem Products
Product Description
Pramlintide acetate is a human amylin analog. Pramlintide acetate is an antidiabetic agent that has also been studied in bowel cancer.
Pramlintide acetate is a synthetic analog of the human hormone amylin, co-secreted with insulin from pancreatic beta-cells. It is an FDA-approved therapeutic (brand name Symlin) used as an adjunct treatment for type 1 and type 2 diabetes mellitus to improve postprandial glucose control by delaying gastric emptying and suppressing glucagon secretion.
Biological Activity I Assay Protocols (From Reference)
Targets
Anticancer; amylin analog; diabetes
Amylin receptors (AMY receptors), calcitonin receptor (CTR). Pramlintide is an amylin analog and agonist. Amylin receptors are heterodimers of the calcitonin receptor (CTR) and one of three receptor activity-modifying proteins (RAMPs), giving rise to the AMY1, AMY2, and AMY3 subtypes.
ln Vitro
In a dose-dependent manner, pramlintide suppresses the growth of HCT-116 and HT-29, with a greater efficacy against the latter (IC50 values of 48.67 and 9.10 μg/mL, respectively) [1]. The antiproliferative effects of 5-fluorouracil, oxaliplatin, or irinotecan were synergistically induced when 5, 10, and 20 μg/mL of Pramlintide was added to HCT-116 and HT-29 [1].
Pramlintide is a potent amylin receptor agonist. It exerts its effects by binding to and activating these receptors, which are found in several tissues including the pancreas, brain, and gastrointestinal tract. This leads to a reduction in postprandial glucagon secretion, slowing of gastric emptying, and promotion of satiety.
ln Vivo
In clinical studies involving patients with type 1 diabetes, pramlintide reduces postprandial blood glucose excursions. It also decreases postprandial glucagon secretion (which is abnormally elevated in type 1 diabetes) and slows the rate of gastric emptying, resulting in better glycemic control and modest weight loss.
Enzyme Assay
A cell-free binding assay for amylin receptors is complex due to their requirement for multiple proteins (CTR + RAMP). Typically, membranes from cells co-expressing human CTR and RAMP1/2/3 are incubated with [125I]-amylin and varying concentrations of pramlintide. After incubation, bound and free ligands are separated by filtration, and the Ki is determined.
Cell Assay
MTT assay [1]
The HCT-116 (wild-type p53) and HT-29 (mutant p53) cells were plated into the 96 well plates at a density of 5×103 in 200 μL of medium per well and the cells were incubated and allowed to attach overnight. The attached cells in the plates were treated with a series of drug concentrations: pramlintide (0–102.4 μg/mL), 5-FU (0–200 μM), OXA (0–300 μM), or IRN (0–160 μM) alone or in combination with three different concentrations of pramlintide (5, 10, and 20 μg/mL) that correspond to 0.5×IC50, IC50, and 2×IC50 in HT-29. Cells grown in medium alone (for treatment with pramlintide only) or containing an equivalent amount of DMSO served as control (for other treatment conditions). [1]
Cells were incubated with the drugs at the indicated concentrations for 72 hours. All measurements were done in triplicate. After that, cell proliferation assay was performed per the manufacturer’s protocol. Briefly, MTT dye was added to the treated cells at a final concentration of 0.5 mg/mL in PBS. Then, the plates were incubated at 37°C for 3 hours and the MTT was discarded and the formazan product was dissolved by adding 100 μL of DMSO to each well, followed by shaking for 5 minutes. Then, the plates were read using an enzyme-linked immunosorbent assay plate reader at 570 nm with a reference wavelength of 690 nm. Cell viability was calculated as follows: absorbance of the experimental group/absorbance of the control group. The IC50 value was defined as the concentration needed for a 50% reduction in cell viability. Dose–effect analyses and IC50 calculations were performed using Compusyn software 1.0
For a cell-based functional assay, cells (e.g., CHO-K1) co-expressing the calcitonin receptor (CTR) and a receptor activity-modifying protein (RAMP1, 2, or 3) are seeded in 96-well plates and loaded with a calcium indicator dye (e.g., Fluo-4). Cells are treated with varying concentrations of pramlintide, and the increase in intracellular calcium is measured to determine the agonist's EC50.
Animal Protocol
Pramlintide is administered by subcutaneous (SC) injection in both research and clinical settings. In diabetic rodent models, its effects are assessed by measuring postprandial blood glucose levels, glucagon concentrations, gastric emptying rate (using a labeled meal), and body weight over time. Efficacy is also assessed via intravenous glucose tolerance tests (IVGTT).
ADME/Pharmacokinetics
Pramlintide is administered subcutaneously and is unsuitable for oral administration due to its peptidic nature. In humans, its absorption is relatively slow, with a peak concentration (Cmax) occurring approximately 1 hour after SC injection. It is rapidly cleared (half-life ~48 minutes) and is degraded primarily in the kidneys.
Toxicity/Toxicokinetics
In clinical use, pramlintide is associated primarily with gastrointestinal side effects, including nausea, vomiting, and anorexia, which are dose-dependent and tend to subside over time. The most serious risk is severe hypoglycemia, particularly when used in conjunction with insulin, necessitating careful dose adjustments.
References

[1]. Pramlintide, an antidiabetic, is antineoplastic in colorectal cancer and synergizes with conventional chemotherapy. Clin Pharmacol. 2018 Mar 5;10:23-29.

Additional Infomation
To investigate the synergistic effect of pramlinide with chemotherapy drugs in colorectal cancer cell lines, we attempted to test three different concentrations of pramlinide, corresponding to 0.5×IC50, IC50, and 2×IC50 for each cell line. However, due to the high concentration requirement of pramlinide in the HCT-116 cell line and the limited drug supply, to maintain consistency with the comparisons studied, we ultimately used pramlinide concentrations of 5, 10, and 20 μg/mL, corresponding to 0.5×IC50, IC50, and 2×IC50 for the HT-29 cell line, respectively. We demonstrated for the first time that, at clinically achievable low concentrations, pramlinide, when used in combination with 5-fluorouracil (5-FU), oxaliplatin (OXA), and irinotecan (IRN), synergistically inhibits the proliferation of colorectal cancer cells in HCT-116 and HT-29 cell lines in a concentration-dependent manner. These results suggest that pramlintide is a novel potential adjuvant anticancer drug with beneficial effects in overcoming resistance to 5-fluorouracil (5-FU), oxaliplatin (OXA), and irinotecan (IRN). Further in vivo and clinical studies are needed to establish pramlintide as an effective chemoprevention and chemotherapy drug for colorectal cancer. [1]
Despite the encouraging results obtained in this study, there are still some limitations. First, we only used the short-term MTT assay to detect the antitumor potential of pramlintide. Second, we only used two representative cell lines to study the differential effects of pramlintide based on p53 status; therefore, the difference in the response of HT-29 and HCT-116 cells to pramlintide may not be caused by p53. [1]
Conclusion: This study is the first to show that pramlintide has anticancer activity against colorectal cancer and has a synergistic effect with 5-FU, oxaliplatin, and irinotecan. Future studies will explore the antiproliferative mechanism of pramlintide and the potential molecular mechanism of its synergistic effect more comprehensively. In addition, other long-term trials (such as colony formation trials) and in vivo colorectal cancer models will be used to analyze the antitumor potential of pramlinin. [1]
Pramlintide (Symlin) was approved by the FDA in 2005 for both type 1 and type 2 diabetes. It is the first and only approved synthetic analog of the pancreatic hormone amylin. By mimicking the natural effects of amylin, it complements insulin therapy to better control blood sugar levels, especially after meals. Its ability to induce weight loss is another key clinical benefit, making it valuable for overweight patients with diabetes.
These protocols are for reference only. InvivoChem does not independently validate these methods.
Physicochemical Properties
Molecular Formula
C173H271N51O55S2
Molecular Weight
4009.44157624245
Exact Mass
4007.9451
CAS #
187887-46-3
Related CAS #
Pramlintide;151126-32-8;Pramlintide TFA
PubChem CID
118984456
Sequence
Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge:Cys2-Cys7); H-Lys-Cys(1)-Asn-Thr-Ala-Thr-Cys(1)-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2.CH3CO2H; L-lysyl-L-cysteinyl-L-asparagyl-L-threonyl-L-alanyl-L-threonyl-L-cysteinyl-L-alanyl-L-threonyl-L-glutaminyl-L-arginyl-L-leucyl-L-alanyl-L-asparagyl-L-phenylalanyl-L-leucyl-L-valyl-L-histidyl-L-seryl-L-seryl-L-asparagyl-L-asparagyl-L-phenylalanyl-glycyl-L-prolyl-L-isoleucyl-L-leucyl-L-prolyl-L-prolyl-L-threonyl-L-asparagyl-L-valyl-glycyl-L-seryl-L-asparagyl-L-threonyl-L-tyrosinamide (2->7)-disulfide acetic acid
SequenceShortening
KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7); KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY
Appearance
White to off-white solid powder
Hydrogen Bond Donor Count
57
Hydrogen Bond Acceptor Count
61
Rotatable Bond Count
110
Heavy Atom Count
281
Complexity
9690
Defined Atom Stereocenter Count
41
SMILES
S1C[C@@H](C(N[C@@H](C)C(N[C@@H]([C@@H](C)O)C(N[C@@H](CCC(N)=O)C(N[C@H](C(N[C@H](C(N[C@@H](C)C(N[C@@H](CC(N)=O)C(N[C@@H](CC2C=CC=CC=2)C(N[C@@H](CC(C)C)C(N[C@@H](C(C)C)C(N[C@@H](CC2=CNC=N2)C(N[C@@H](CO)C(N[C@@H](CO)C(N[C@@H](CC(N)=O)C(N[C@@H](CC(N)=O)C(N[C@@H](CC2C=CC=CC=2)C(NCC(N2CCC[C@H]2C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC(C)C)C(N2CCC[C@H]2C(N2CCC[C@H]2C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N)=O)CC2C=CC(=CC=2)O)=O)[C@@H](C)O)=O)CC(N)=O)=O)CO)=O)=O)C(C)C)=O)CC(N)=O)=O)[C@@H](C)O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC(C)C)=O)CCCNC(=N)N)=O)=O)=O)=O)NC([C@H]([C@@H](C)O)NC([C@H](C)NC([C@H]([C@@H](C)O)NC([C@H](CC(N)=O)NC([C@H](CS1)NC([C@H](CCCCN)N)=O)=O)=O)=O)=O)=O.OC(C)=O
InChi Key
DTPWZYSUQQHRKD-VIUAGAKSSA-N
InChi Code
InChI=1S/C171H267N51O53S2.C2H4O2/c1-21-81(12)130(163(268)207-110(56-78(6)7)169(274)222-53-33-42-118(222)170(275)221-52-32-41-117(221)160(265)219-135(89(20)230)167(272)206-109(66-125(180)238)151(256)212-128(79(8)9)161(266)186-68-126(239)192-111(70-223)154(259)203-107(64-123(178)236)152(257)218-134(88(19)229)166(271)195-98(136(181)241)57-92-43-45-94(231)46-44-92)214-159(264)116-40-31-51-220(116)127(240)69-187-141(246)101(58-90-34-24-22-25-35-90)199-148(253)105(62-121(176)234)201-149(254)106(63-122(177)235)202-155(260)112(71-224)209-156(261)113(72-225)208-146(251)103(60-93-67-184-75-188-93)205-162(267)129(80(10)11)213-150(255)100(55-77(4)5)198-145(250)102(59-91-36-26-23-27-37-91)200-147(252)104(61-120(175)233)196-137(242)82(13)189-144(249)99(54-76(2)3)197-142(247)96(39-30-50-185-171(182)183)193-143(248)97(47-48-119(174)232)194-165(270)132(86(17)227)215-138(243)83(14)190-157(262)114-73-276-277-74-115(210-140(245)95(173)38-28-29-49-172)158(263)204-108(65-124(179)237)153(258)217-131(85(16)226)164(269)191-84(15)139(244)216-133(87(18)228)168(273)211-114;1-2(3)4/h22-27,34-37,43-46,67,75-89,95-118,128-135,223-231H,21,28-33,38-42,47-66,68-74,172-173H2,1-20H3,(H2,174,232)(H2,175,233)(H2,176,234)(H2,177,235)(H2,178,236)(H2,179,237)(H2,180,238)(H2,181,241)(H,184,188)(H,186,266)(H,187,246)(H,189,249)(H,190,262)(H,191,269)(H,192,239)(H,193,248)(H,194,270)(H,195,271)(H,196,242)(H,197,247)(H,198,250)(H,199,253)(H,200,252)(H,201,254)(H,202,260)(H,203,259)(H,204,263)(H,205,267)(H,206,272)(H,207,268)(H,208,251)(H,209,261)(H,210,245)(H,211,273)(H,212,256)(H,213,255)(H,214,264)(H,215,243)(H,216,244)(H,217,258)(H,218,257)(H,219,265)(H4,182,183,185);1H3,(H,3,4)/t81-,82-,83-,84-,85+,86+,87+,88+,89+,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,128-,129-,130-,131-,132-,133-,134-,135-;/m0./s1
Chemical Name
acetic acid;(2S)-N-[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-4-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-4-amino-1-[[(2S)-4-amino-1-[[(2S)-1-[[2-[(2S)-2-[[(2S,3S)-1-[[(2S)-1-[(2S)-2-[(2S)-2-[[(2S,3R)-1-[[(2S)-4-amino-1-[[(2S)-1-[[2-[[(2S)-1-[[(2S)-4-amino-1-[[(2S,3R)-1-[[(2S)-1-amino-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-2-oxoethyl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]carbamoyl]pyrrolidine-1-carbonyl]pyrrolidin-1-yl]-4-methyl-1-oxopentan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]carbamoyl]pyrrolidin-1-yl]-2-oxoethyl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-1-oxopropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]-2-[[(2S,3R)-2-[[(2S)-2-[[(4R,7S,10S,13S,16S,19R)-16-(2-amino-2-oxoethyl)-19-[[(2S)-2,6-diaminohexanoyl]amino]-7,13-bis[(1R)-1-hydroxyethyl]-10-methyl-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentazacycloicosane-4-carbonyl]amino]propanoyl]amino]-3-hydroxybutanoyl]amino]pentanediamide
Synonyms
187887-46-3; Triproamylin acetate; UNII-JS41L76X7I; Tripro-amylin acetate; Pramlintide acetate anhydrous;
HS Tariff Code
2934.99.9001
Storage

Powder      -20°C    3 years

                     4°C     2 years

In solvent   -80°C    6 months

                  -20°C    1 month

Note: Please store this product in a sealed and protected environment, avoid exposure to moisture.
Shipping Condition
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
Solubility Data
Solubility (In Vitro)
H2O: 50 mg/mL (12.47 mM)
Solubility (In Vivo)
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.

Injection Formulations
(e.g. IP/IV/IM/SC)
Injection Formulation 1: DMSO : Tween 80: Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution 50 μL Tween 80 850 μL Saline)
*Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution.
Injection Formulation 2: DMSO : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO 400 μLPEG300 50 μL Tween 80 450 μL Saline)
Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO 900 μL Corn oil)
Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals).
View More

Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO 900 μL (20% SBE-β-CD in saline)]
*Preparation of 20% SBE-β-CD in Saline (4°C,1 week): Dissolve 2 g SBE-β-CD in 10 mL saline to obtain a clear solution.
Injection Formulation 5: 2-Hydroxypropyl-β-cyclodextrin : Saline = 50 : 50 (i.e. 500 μL 2-Hydroxypropyl-β-cyclodextrin 500 μL Saline)
Injection Formulation 6: DMSO : PEG300 : castor oil : Saline = 5 : 10 : 20 : 65 (i.e. 50 μL DMSO 100 μLPEG300 200 μL castor oil 650 μL Saline)
Injection Formulation 7: Ethanol : Cremophor : Saline = 10: 10 : 80 (i.e. 100 μL Ethanol 100 μL Cremophor 800 μL Saline)
Injection Formulation 8: Dissolve in Cremophor/Ethanol (50 : 50), then diluted by Saline
Injection Formulation 9: EtOH : Corn oil = 10 : 90 (i.e. 100 μL EtOH 900 μL Corn oil)
Injection Formulation 10: EtOH : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL EtOH 400 μLPEG300 50 μL Tween 80 450 μL Saline)


Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium)
Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose
Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals).
View More

Oral Formulation 3: Dissolved in PEG400
Oral Formulation 4: Suspend in 0.2% Carboxymethyl cellulose
Oral Formulation 5: Dissolve in 0.25% Tween 80 and 0.5% Carboxymethyl cellulose
Oral Formulation 6: Mixing with food powders


Note: Please be aware that the above formulations are for reference only. InvivoChem strongly recommends customers to read literature methods/protocols carefully before determining which formulation you should use for in vivo studies, as different compounds have different solubility properties and have to be formulated differently.

 (Please use freshly prepared in vivo formulations for optimal results.)
Preparing Stock Solutions 1 mg 5 mg 10 mg
1 mM 0.2494 mL 1.2471 mL 2.4941 mL
5 mM 0.0499 mL 0.2494 mL 0.4988 mL
10 mM 0.0249 mL 0.1247 mL 0.2494 mL

*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.

Calculator

Molarity Calculator allows you to calculate the mass, volume, and/or concentration required for a solution, as detailed below:

  • Calculate the Mass of a compound required to prepare a solution of known volume and concentration
  • Calculate the Volume of solution required to dissolve a compound of known mass to a desired concentration
  • Calculate the Concentration of a solution resulting from a known mass of compound in a specific volume
An example of molarity calculation using the molarity calculator is shown below:
What is the mass of compound required to make a 10 mM stock solution in 5 ml of DMSO given that the molecular weight of the compound is 350.26 g/mol?
  • Enter 350.26 in the Molecular Weight (MW) box
  • Enter 10 in the Concentration box and choose the correct unit (mM)
  • Enter 5 in the Volume box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 17.513 mg appears in the Mass box. In a similar way, you may calculate the volume and concentration.

Dilution Calculator allows you to calculate how to dilute a stock solution of known concentrations. For example, you may Enter C1, C2 & V2 to calculate V1, as detailed below:

What volume of a given 10 mM stock solution is required to make 25 ml of a 25 μM solution?
Using the equation C1V1 = C2V2, where C1=10 mM, C2=25 μM, V2=25 ml and V1 is the unknown:
  • Enter 10 into the Concentration (Start) box and choose the correct unit (mM)
  • Enter 25 into the Concentration (End) box and select the correct unit (mM)
  • Enter 25 into the Volume (End) box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 62.5 μL (0.1 ml) appears in the Volume (Start) box
g/mol

Molecular Weight Calculator allows you to calculate the molar mass and elemental composition of a compound, as detailed below:

Note: Chemical formula is case sensitive: C12H18N3O4  c12h18n3o4
Instructions to calculate molar mass (molecular weight) of a chemical compound:
  • To calculate molar mass of a chemical compound, please enter the chemical/molecular formula and click the “Calculate’ button.
Definitions of molecular mass, molecular weight, molar mass and molar weight:
  • Molecular mass (or molecular weight) is the mass of one molecule of a substance and is expressed in the unified atomic mass units (u). (1 u is equal to 1/12 the mass of one atom of carbon-12)
  • Molar mass (molar weight) is the mass of one mole of a substance and is expressed in g/mol.
/

Reconstitution Calculator allows you to calculate the volume of solvent required to reconstitute your vial.

  • Enter the mass of the reagent and the desired reconstitution concentration as well as the correct units
  • Click the “Calculate” button
  • The answer appears in the Volume (to add to vial) box
In vivo Formulation Calculator (Clear solution)
Step 1: Enter information below (Recommended: An additional animal to make allowance for loss during the experiment)
Step 2: Enter in vivo formulation (This is only a calculator, not the exact formulation for a specific product. Please contact us first if there is no in vivo formulation in the solubility section.)
+
+
+

Calculation results

Working concentration mg/mL;

Method for preparing DMSO stock solution mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.

Method for preparing in vivo formulation:Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O,mix and clarify.

(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
             (2) Be sure to add the solvent(s) in order.

Clinical Trial Information
Title:Tailoring Obesity Treatment Trial
Status:Withdrawn
updateDate:2026-04-17
Ctid:NCT06619015

Link: https://clinicaltrials.gov/ct2/show/NCT06619015

Conditions:Obesity|Appetite Regulation|PreDiabetes
Interventions:Sodium Chloride 0.9% Inj
Phase:Phase 2/Phase 3
Title:Co-administration of Pramlintide and Insulin Via an Automated Dual-hormone Artificial Pancreas System in Adults With Type 1 Diabetes
Status:Unknown status
updateDate:2023-03-15
Ctid:NCT04243629

Link: https://clinicaltrials.gov/ct2/show/NCT04243629

Conditions:Diabetes Mellitus, Type 1|Type 1 Diabetes|Postprandial Hyperglycemia
Interventions:Pramlintide Acetate
Phase:N/A
Title:Alleviating Carbohydrate Counting for Patients With Type 1 Diabetes Using a Novel Insulin-plus-pramlintide Artificial Pancreas
Status:Completed
updateDate:2022-10-10
Ctid:NCT04163874

Link: https://clinicaltrials.gov/ct2/show/NCT04163874

Conditions:Type 1 Diabetes|Type 1 Diabetes Mellitus|Hyperglycemia, Postprandial
Interventions:Placebo
Phase:N/A
View More

Title:Effects of Pramlintide on Endogenous Production of Very-low-density-lipoprotein (VLDL)-Triglyceride and Glucose in the Post Prandial State in T2DM
Status:Withdrawn
updateDate:2021-07-22
Ctid:NCT00732147

Link: https://clinicaltrials.gov/ct2/show/NCT00732147

Conditions:Type 2 Diabetes
Interventions:Placebo
Phase:N/A
Title:Effect of a Fixed Pramlintide: Insulin Dose Ratio on Postprandial Glucose in Type 1 Diabetes Mellitus
Status:Completed
updateDate:2018-11-02
Ctid:NCT02500979

Link: https://clinicaltrials.gov/ct2/show/NCT02500979

Conditions:Type 1 Diabetes Mellitus
Interventions:Regular insulin U-100
Phase:Phase 1
Title:The Effect of Byetta and Symlin on Post-meal Meal Blood Sugar Levels in Children With Type 2 Diabetes
Status:Completed
updateDate:2017-04-24
Ctid:NCT00950677

Link: https://clinicaltrials.gov/ct2/show/NCT00950677

Conditions:Type 2 Diabetes
Interventions:Symlin (pramlintide)
Phase:Phase 4
Title:Evaluation of the Effect of Pramlintide on Satiety and Food Intake
Status:Completed
updateDate:2015-10-21
Ctid:NCT00042601

Link: https://clinicaltrials.gov/ct2/show/NCT00042601

Conditions:Diabetes Mellitus, Type 1|Diabetes Mellitus, Type 2
Interventions:Placebo
Phase:Phase 2
Title:Evaluation of the Bioavailability of Pramlintide
Status:Completed
updateDate:2015-09-23
Ctid:NCT00042471

Link: https://clinicaltrials.gov/ct2/show/NCT00042471

Conditions:Diabetes Mellitus, Type 1|Diabetes Mellitus, Type 2
Interventions:Pramlintide acetate
Phase:Phase 2
Title:Evaluation of Dose-titration of Pramlintide During Initiation of Therapy in Patients Trying to Improve Glucose Control
Status:Completed
updateDate:2015-09-23
Ctid:NCT00042458

Link: https://clinicaltrials.gov/ct2/show/NCT00042458

Conditions:Diabetes Mellitus, Type 1
Interventions:Placebo
Phase:Phase 3
Title:Study of the Long-Term Safety of Pramlintide in Subjects With Type 1 Diabetes Mellitus
Status:Completed
updateDate:2015-09-23
Ctid:NCT00107107

Link: https://clinicaltrials.gov/ct2/show/NCT00107107

Conditions:Diabetes Mellitus, Type 1
Interventions:pramlintide acetate
Phase:Phase 3
Title:A Study to Examine the Long Term Effect of Pramlintide on Body Weight and Its Safety and Tolerability in Obese Subjects
Status:Completed
updateDate:2015-06-11
Ctid:NCT00189514

Link: https://clinicaltrials.gov/ct2/show/NCT00189514

Conditions:Obesity
Interventions:placebo
Phase:Phase 2
Title:Exploratory Study to Evaluate Various Pharmacodynamic Effects of Subcutaneously Infused or Injected Pramlintide in Obese Subjects
Status:Completed
updateDate:2015-06-11
Ctid:NCT00444561

Link: https://clinicaltrials.gov/ct2/show/NCT00444561

Conditions:Overweight|Obesity
Interventions:pramlintide acetate
Phase:Phase 2
Title:Evaluation of an Orally Administered Medication When Taken in Conjunction With Pramlintide
Status:Completed
updateDate:2015-05-21
Ctid:NCT00044707

Link: https://clinicaltrials.gov/ct2/show/NCT00044707

Conditions:Diabetes Mellitus, Non-Insulin-Dependent
Interventions:Pramlintide acetate
Phase:Phase 2
Title:Clinical Utility and Safety of Pramlintide in Subjects With Type 1 and Type 2 Diabetes Mellitus
Status:Completed
updateDate:2015-05-21
Ctid:NCT00108004

Link: https://clinicaltrials.gov/ct2/show/NCT00108004

Conditions:Type 1 Diabetes Mellitus|Type 2 Diabetes Mellitus
Interventions:pramlintide acetate
Phase:Phase 3
Title:Study to Examine Safety, Tolerability, and Effect on Body Weight of Metreleptin Administered in Conjunction With Pramlintide in Obese and Overweight Subjects
Status:Completed
updateDate:2015-04-15
Ctid:NCT00673387

Link: https://clinicaltrials.gov/ct2/show/NCT00673387

Conditions:Overweight|Obesity
Interventions:placebo-M
Phase:Phase 2
Title:A Study to Characterize Regimens of Basal Insulin Intensified With Either Symlin® or Rapid Acting Insulin in Patients With Type 2 Diabetes
Status:Completed
updateDate:2015-04-14
Ctid:NCT00467649

Link: https://clinicaltrials.gov/ct2/show/NCT00467649

Conditions:Type 2 Diabetes Mellitus
Interventions:basal insulin (Lantus® insulin glargine, or Levemir® insulin detemir)
Phase:Phase 4
Title:A Study to Evaluate the Effect on Body Weight of Leptin Administered in Conjunction With Pramlintide in Overweight and Obese Subjects
Status:Completed
updateDate:2015-04-14
Ctid:NCT00392925

Link: https://clinicaltrials.gov/ct2/show/NCT00392925

Conditions:Overweight|Obesity
Interventions:Pramlintide acetate 180 mcg
Phase:Phase 2
Title:A Study to Examine the Effect of Pramlintide on Body Weight and Its Safety and Tolerability in Obese Subjects
Status:Completed
updateDate:2015-04-10
Ctid:NCT00112021

Link: https://clinicaltrials.gov/ct2/show/NCT00112021

Conditions:Obesity
Interventions:pramlintide acetate
Phase:Phase 2
Title:A Study Evaluating the Efficacy and Safety of Adding Symlin® to Lantus® (Insulin Glargine) in Subjects With Type 2 Diabetes
Status:Completed
updateDate:2015-03-31
Ctid:NCT00240253

Link: https://clinicaltrials.gov/ct2/show/NCT00240253

Conditions:Type 2 Diabetes Mellitus
Interventions:pramlintide acetate
Phase:Phase 4
Title:An Observational Study Evaluating SYMLIN® (Pramlintide Acetate) Injection Use in Insulin Using Patients With Type 2 and Type 1 Diabetes
Status:Completed
updateDate:2015-03-25
Ctid:NCT00229658

Link: https://clinicaltrials.gov/ct2/show/NCT00229658

Conditions:Type 1 Diabetes Mellitus|Type 2 Diabetes Mellitus
Interventions:pramlintide acetate
Phase:
Title:A Study to Examine the Safety, Tolerability, and Body Weight Effect of Pramlintide Alone and in Combination With Oral Antiobesity Agents in Overweight and Obese Subjects
Status:Completed
updateDate:2015-03-06
Ctid:NCT00402077

Link: https://clinicaltrials.gov/ct2/show/NCT00402077

Conditions:Overweight|Obesity
Interventions:placebo
Phase:Phase 2
Title:A Study to Evaluate Symlin in Adolescent Subjects With Type 1 Diabetes Mellitus
Status:Completed
updateDate:2015-03-06
Ctid:NCT00313183

Link: https://clinicaltrials.gov/ct2/show/NCT00313183

Conditions:Type 1 Diabetes Mellitus
Interventions:pramlintide acetate
Phase:Phase 2
Title:Effect of Different Fixed Pramlintide:Insulin Dose Ratios on Postprandial Glucose in T1DM
Status:Completed
updateDate:2014-10-20
Ctid:NCT01708044

Link: https://clinicaltrials.gov/ct2/show/NCT01708044

Conditions:Type 1 Diabetes
Interventions:Pramlintide acetate
Phase:Phase 1

Contact Us