yingweiwo

Glucagon (Human) (Glukagon; Hyperglycemic-glycogenolytic factor)

Alias: Glucagon
Cat No.:V64438 Purity: ≥98%
Glucagon has significant effects on protein and amino acid (AA) metabolism.
Glucagon (Human) (Glukagon; Hyperglycemic-glycogenolytic factor)
Glucagon (Human) (Glukagon; Hyperglycemic-glycogenolytic factor) Chemical Structure CAS No.: 9007-92-5
Product category: Others 12
This product is for research use only, not for human use. We do not sell to patients.
Size Price Stock Qty
1mg
5mg
10mg
Other Sizes

Other Forms of Glucagon (Human) (Glukagon; Hyperglycemic-glycogenolytic factor):

  • Glucagon HCl
  • Glucagon 4HCl
Official Supplier of:
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Top Publications Citing lnvivochem Products
Purity & Quality Control Documentation

Purity: ≥98%

Product Description
Glucagon has significant effects on protein and amino acid (AA) metabolism. Glucagon inhibits/disrupts the binding of amino acid (AA)s to liver, muscle and pancreatic proteins, increases nitrogen excretion, promotes hepatic urea synthesis, and increases the concentration of hepatic transaminases and urea cycle enzymes. Glucagon can promote the uptake of amino acid (AA)s by the liver, enhance the combination of amino acid (AA)s with liver glycogen, and reduce the concentration of amino acid (AA)s in the blood.
Glucagon is a 29-amino acid polypeptide hormone secreted by the alpha cells of the pancreas, serving as a key counter-regulatory hormone to insulin in glucose homeostasis . Its primary function is to increase blood glucose levels by stimulating hepatic glycogenolysis and gluconeogenesis, effectively acting as a hyperglycemic agent for the treatment of severe hypoglycemia . As a pancreatic hormone (ATC code H04AA01), glucagon also relaxes gastrointestinal smooth muscle, making it useful as a diagnostic aid during radiologic examinations .
Glucagon is a peptide hormone produced by the alpha cells of the pancreas that plays a crucial role in regulating blood glucose levels. It acts as a counter-regulatory hormone to insulin, which lowers blood glucose levels. Glucagon stimulates the liver to convert stored glycogen into glucose through a process known as glycogenolysis. The hormone also significantly impacts protein and amino acid metabolism. It is used clinically as an emergency treatment for severe hypoglycemia.
Biological Activity I Assay Protocols (From Reference)
Targets
Peptide hormone; Glucagon receptor (GCGR) and Glucagon-like peptide-1 receptor (GLP-1R).
The primary target of glucagon is the glucagon receptor (GCGR), a G protein-coupled receptor expressed primarily in the liver and kidneys. When blood glucose levels drop, glucagon binds to specific glucagon receptors on the cell membrane. This binding activates adenylate cyclase, increasing cAMP levels and activating protein kinase A (PKA), which in turn stimulates glycogenolysis and gluconeogenesis.
ln Vitro
Glucagon exerts its effects by binding to G-protein-coupled glucagon receptors (GCGR) predominantly expressed in hepatocytes . This binding activates adenylate cyclase, increasing intracellular cyclic AMP (cAMP) levels, which in turn stimulates glycogenolysis and gluconeogenesis to release glucose from liver glycogen stores . Glucagon has also been shown to stimulate adipose lipolysis and myocardial contractility, though some evidence suggests these effects may require pharmacological concentrations above 0.1 nM .
In vitro studies demonstrate that glucagon stimulates the breakdown of glycogen to glucose in the liver. The hormone inhibits the incorporation of amino acids into proteins of the liver, muscle, and pancreas, increasing nitrogen excretion and promoting hepatic urea synthesis. Glucagon increases the concentration of hepatic transaminases and urea cycle enzymes, promoting hepatic uptake of amino acids and their conversion into liver glycogen.
ln Vivo
In Vivo Activity
When administered for severe hypoglycemia, glucagon typically raises blood glucose within 10 minutes, with time to maximum glucose concentration ranging from 5-20 minutes (IV) to 30 minutes (IM) . The median glucose excursion ranges from 2.6 to 6.2 mmol/L depending on dose and baseline glucose levels . Glucagon also relaxes gastrointestinal smooth muscle within 1 minute (IV) or 5-15 minutes (IM), with duration of 5-40 minutes . The intranasal formulation (3 mg) is also effective, with over 99% of hypoglycemic patients achieving treatment success .
Pharmacokinetics
Glucagon has a very short half-life of approximately 3-6 minutes in blood, with a metabolic clearance rate of about 10 mL/kg/min . After subcutaneous administration, peak plasma concentration is reached within 10-20 minutes, and the half-life is approximately 42 minutes (SC) or 26 minutes (IM) . The liver and kidney are the major sites of clearance, each contributing about 30% to overall metabolic clearance . The absolute bioavailability of intranasal glucagon is approximately 16% relative to injectable formulations . After intraperitoneal administration, time to peak concentration is approximately 11 minutes, with an elimination half-life of about 19 minutes .
Toxicity
The most common adverse effect of glucagon is nausea, occurring in up to 35% of patients . Hypertension may occur for up to 2 hours following administration, particularly during gastrointestinal procedures . Less common adverse reactions include vomiting, headache, and rare hypersensitivity reactions (including anaphylaxis) due to its protein structure . Glucagon is contraindicated in patients with pheochromocytoma and those with known hypersensitivity . It is pregnancy category B, with no special precautions needed during breastfeeding due to its high molecular weight .
In vivo studies show that glucagon raises the concentration of glucose and fatty acids in the bloodstream. It stimulates glycogenolysis in the liver, releasing glucose into the bloodstream. Glucagon also promotes hepatic urea synthesis and increases nitrogen excretion. The hormone plays an important role in the regulation of blood glucose concentration, ketone metabolism, and several other biochemical and physiological processes.
Enzyme Assay
Non-cellular assays for glucagon typically involve receptor binding studies using membrane preparations from liver or other GCGR-expressing tissues. Radiolabeled glucagon is used in competition binding assays to determine binding affinity and receptor density. cAMP production assays measure the activation of adenylate cyclase in response to glucagon stimulation. These cell-free systems allow for characterization of glucagon-receptor interactions.
Cell Assay
Cellular assays for glucagon are conducted using hepatocytes or cell lines expressing the glucagon receptor. Cells are treated with glucagon, and downstream signaling is assessed by measuring cAMP levels, PKA activity, and the phosphorylation of downstream targets. Glycogen breakdown is measured by quantifying glucose release into the culture medium. Gene expression changes are analyzed by qPCR for gluconeogenic genes.
Animal Protocol
In vivo animal experiments for glucagon typically involve administration of the hormone to rodents or other animals. Blood glucose levels are measured at various time points after administration to assess the glycemic response. Insulin and glucagon levels may be measured to evaluate the counter-regulatory response. These studies are used to investigate glucose homeostasis and the effects of glucagon receptor agonists or antagonists.
ADME/Pharmacokinetics
Absorption, Distribution and Excretion
Following intravenous injection of 1 mg glucagon, the peak plasma concentration (Cmax) was 7.9 ng/mL, and the time to peak concentration (Tmax) was 20 minutes. Following intramuscular injection of 1 mg glucagon, the peak plasma concentration (Cmax) was 6.9 ng/mL, and the time to peak concentration (Tmax) was 13 minutes. Following nasal administration of 3 mg glucagon powder, the peak plasma concentration (Cmax) was 6130 pg/mL, and the time to peak concentration (Tmax) was 15 minutes. The elimination pathway of glucagon is not fully elucidated in the literature, but animal models show that the kidneys and liver play significant roles in its clearance. The liver and kidneys are each responsible for clearing approximately 30% of glucagon. The volume of distribution of glucagon is 0.25 L/kg. The apparent volume of distribution is 885 liters. The clearance rate of 1 mg intravenously administered glucagon is 13.5 mL/min/kg.
Because glucagon is a polypeptide, it is destroyed in the gastrointestinal tract and must therefore be administered via parenteral route.
Metabolism/Metabolites
Glucagon is a protein and is therefore metabolized into smaller polypeptides and amino acids in the liver, kidneys, and plasma.
Biological Half-Life
The half-life of intramuscularly administered glucagon is 26 minutes. The half-life of nasal glucagon powder is approximately 35 minutes. The half-life of glucagon administered via subcutaneous auto-injector or pre-filled syringe is 32 minutes.
The plasma half-life of glucagon is approximately 3–10 minutes.
Pharmacokinetic properties of glucagon include a very short half-life in circulation (approximately 3-6 minutes) due to rapid degradation by proteases and clearance by the liver and kidneys. The hormone is administered by subcutaneous, intramuscular, or intravenous injection for emergency treatment of hypoglycemia. It is available as a lyophilized powder for reconstitution with sterile water. The hormone is not orally bioavailable due to its peptide nature.
Toxicity/Toxicokinetics
Effects During Pregnancy and Lactation
◉ Overview of Use During Lactation
Currently, there is no clinical information regarding the use of glucagon during lactation. Because glucagon is a large protein molecule with a molecular weight of 3483 Da, its concentration in breast milk is likely very low, and it is unlikely to be absorbed as it is likely to be destroyed in the infant's gastrointestinal tract. Glucagon can also be safely administered directly to the infant by injection. No special precautions are required.
◉ Effects on Breastfed Infants
As of the revision date, no relevant published information was found.
◉ Effects on Lactation and Breast Milk
As of the revision date, no relevant published information was found.
Protein Binding
The binding of glucagon to proteins in serum is not described in the literature.
Interactions
Concurrent administration of adrenaline can enhance and prolong the hyperglycemic effect of glucagon.
When glucagon is used concurrently with anticholinergic drugs, the response is not significantly enhanced compared to using either drug alone; however, the addition of an anticholinergic drug can lead to adverse reactions.
Concurrent use of coumarin or indanedione derivative anticoagulants and glucagon may enhance anticoagulation; it has been reported that abnormally high doses (e.g., 25 mg or more daily for 2 days or longer) can enhance anticoagulant activity.
Toxicological data for glucagon indicate that it is safe for use at therapeutic doses. Adverse effects are typically related to its pharmacological action and include nausea, vomiting, and transient hyperglycemia. At high doses, glucagon may cause hypokalemia and tachycardia. The hormone is contraindicated in patients with pheochromocytoma and insulinoma. No significant toxicity has been reported at clinically relevant doses.
References
[1]. Bromer WW, Chance RE. Zinc glucagon depression of blood amino acids in rabbits. Diabetes. 1969 Nov;18(11):748-54.
Additional Infomation
Glucagon is a peptide hormone composed of 29 amino acids, with the following amino acid residues in order: His, Ser, Gln, Gly, Thr, Phe, Thr, Ser, Asp, Tyr, Ser, Lys, Tyr, Leu, Asp, Ser, Arg, Arg, Ala, Gln, Asp, Phe, Val, Gln, Trp, Leu, Met, Asn, and Thr. Glucagon is a hormone composed of 29 amino acids that can be used as an adjunct diagnostic agent in radiological examinations, temporarily inhibit gastrointestinal motility, and treat severe hypoglycemia. Glucagon raises blood glucose levels by activating hepatic glucagon receptors, stimulating glycogenolysis and glucose release. Glucagon was approved by the U.S. Food and Drug Administration (FDA) on November 14, 1960.
Recombinant glucagon is a recombinant form of the endogenous polypeptide hormone glucagon, composed of 29 amino acids. It is responsible for releasing stored glucose, thereby raising blood glucose levels. Clinical applications: imaging examinations and auxiliary diagnosis of hypoglycemia.
Glucagon is a pancreatic peptide composed of 29 amino acids, derived from proglucagon, and is also a precursor of intestinal glucagon-like peptides. Glucagon is secreted by pancreatic α cells and plays an important role in regulating blood glucose concentration, ketone body metabolism, and many other biochemical and physiological processes. (Excerpt from Gilman et al., Goodman and Gilman's Pharmacological Basis, 9th ed., p. 1511)
See also: Glucagon hydrochloride (salt form)...see more...
Drug Indications
Glucagon is suitable for auxiliary diagnosis in radiological examinations, can temporarily inhibit gastrointestinal motility, and is used to treat severe hypoglycemia.
FDA Label
Ogluo is indicated for the treatment of severe hypoglycemia in adults, adolescents, and children aged 2 years and older with diabetes.
Baqsimi is indicated for the treatment of severe hypoglycemia in adults, adolescents, and children aged 4 years and older with diabetes.
Treatment of Hypoglycemia
Mechanism of Action
Glucagon binds to glucagon receptors, activating… Activation of Gsα and Gq activates adenylate cyclase, thereby increasing intracellular levels of cyclic adenosine monophosphate (cAMP) and activating protein kinase A. Activation of Gq activates phospholipase C, increasing the production of inositol 1,4,5-triphosphate and releasing intracellular calcium ions. Protein kinase A phosphorylates glycogen phosphorylase kinase, which in turn phosphorylates glycogen phosphorylase, leading to glycogenolysis. Glucagon also relaxes the smooth muscle of the stomach, duodenum, small intestine, and colon.
Glucagon increases blood glucose levels by mobilizing liver glycogen, and is therefore only effective when liver glycogen is adequate. Patients with depleted glycogen reserves (e.g., starvation, adrenal insufficiency, alcoholic hypoglycemia) do not respond to glucagon.
In addition to its blood glucose-raising effect, glucagon also produces extrahepatic effects. Although its exact mechanism of action is not fully understood, glucagon relaxes the smooth muscle of the stomach, duodenum, small intestine, and colon. The drug has also been shown to inhibit the secretion of gastric and pancreatic juices.
It promotes liver glycogenolysis and gluconeogenesis. It stimulates adenylate cyclase to produce more cyclic adenosine monophosphate (cAMP), which participates in a series of enzymatic reactions. Ultimately, this leads to increased plasma glucose levels, smooth muscle relaxation, and myocardial contractility. Glycogen stored in the liver is essential for glucagon to exert its antihyperglycemic effect.
Therapeutic Uses
Gastrointestinal drug; protein synthesis inhibitor
Glucagon is used to treat lower esophageal obstruction caused by foreign bodies (including food boluses). /Not included in US product label/
For patients unresponsive to conventional therapy, glucagon may be used to treat myocardial depression caused by calcium channel blockers. /Not included in US product label/
High-dose intravenous glucagon is used to treat cardiotoxicity caused by overdose of beta-adrenergic blockers, particularly bradycardia and hypotension. Glucagon may be used in combination with isoproterenol or dobutamine. Because glucagon lowers serum potassium levels, patients receiving treatment may require potassium supplementation. /Not included in US product label/
For more complete data on the therapeutic uses of glucagon (19 in total), please visit the HSDB record page.
Drug Warnings
…Effective only with parenteral administration. Its hyperglycemic effect is relatively short-lived. …/Patients should be given carbohydrates as soon as possible after a reaction/. Sugar supplementation is especially important for adolescents…
Because glucagon is a protein, the possibility of allergic reactions should be considered. Side effects/adverse reactions: Medical attention is only necessary if symptoms persist or are bothersome: nausea or vomiting—incidence usually depends on the dose and (when administered intravenously) the rate of injection; slowing the rate of intravenous injection can reduce these reactions. Glucagon should not be used to treat birth asphyxia or hypoglycemia in premature infants or infants with intrauterine growth restriction. Glucagon has been used as an adjunct in the diagnosis of insulinomas and pheochromocytomas; however, due to safety concerns, the United States Pharmacopeia (USP) Advisory Panel generally does not recommend this use. Pharmacodynamics: Glucagon is indicated for adjunctive diagnosis during radiological examinations and may temporarily suppress gastrointestinal motility and cause severe hypoglycemia. Glucagon raises blood glucose levels by activating hepatic glucagon receptors, stimulating glycogenolysis and glucose release. The duration of action of glucagon is short. Glucagon may cause hyperglycemia in diabetic patients.
Other information includes glucagon's role as a counter-regulatory hormone to insulin, raising blood glucose levels. It is used clinically as an emergency treatment for severe hypoglycemia. Glucagon is also used in diagnostic procedures such as the glucagon stimulation test for growth hormone deficiency. The hormone is available as a prescription drug in various formulations. It is a 29-amino acid peptide with the sequence HSQGTFTSDYSKYLDSRRAQDFVQWLMNT. The hormone is also known as hyperglycemic-glycogenolytic factor.
These protocols are for reference only. InvivoChem does not independently validate these methods.
Physicochemical Properties
Molecular Formula
C153H225N43O49S
Molecular Weight
3482.74729999998
Exact Mass
3516.59
CAS #
9007-92-5
Related CAS #
Glucagon HCl; 28270-04-4; Glucagon (Human) (Glukagon; Hyperglycemic-glycogenolytic factor); 9007-92-5; Glucagon 4HCl; 16941-32-5; Glucagon (1-29), bovine, human, porcine; 16941-32-5;
PubChem CID
16132283
Sequence
His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr
SequenceShortening
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Appearance
FINE, WHITE OR FAINTLY COLORED, CRYSTALLINE POWDER
Boiling Point
230ºC at 760 mm Hg
Melting Point
-15ºC
LogP
0.391
Hydrogen Bond Donor Count
55
Hydrogen Bond Acceptor Count
55
Rotatable Bond Count
115
Heavy Atom Count
246
Complexity
8160
Defined Atom Stereocenter Count
31
SMILES
C12C=CC=CC=1NC=C2C[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@H](C(=O)O)[C@H](O)C)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H]([C@H](O)C)NC(=O)[C@@H](NC(=O)[C@H]([C@H](O)C)NC(=O)CNC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1N=CNC=1)CC1C=CC=CC=1)CC1C=CC(O)=CC=1)CC1=CC=C(O)C=C1)CC1=CC=CC=C1.Cl
InChi Key
MASNOZXLGMXCHN-ZLPAWPGGSA-N
InChi Code
InChI=1S/C153H225N43O49S/c1-72(2)52-97(133(226)176-96(47-51-246-11)132(225)184-104(60-115(159)209)143(236)196-123(78(10)203)151(244)245)179-137(230)103(58-83-64-167-89-29-19-18-28-87(83)89)183-131(224)95(43-46-114(158)208)177-148(241)120(74(5)6)194-141(234)101(54-79-24-14-12-15-25-79)182-138(231)105(61-117(211)212)185-130(223)94(42-45-113(157)207)171-124(217)75(7)170-127(220)91(31-22-49-165-152(160)161)172-128(221)92(32-23-50-166-153(162)163)174-146(239)110(69-199)191-140(233)107(63-119(215)216)186-134(227)98(53-73(3)4)178-135(228)99(56-81-33-37-85(204)38-34-81)180-129(222)90(30-20-21-48-154)173-145(238)109(68-198)190-136(229)100(57-82-35-39-86(205)40-36-82)181-139(232)106(62-118(213)214)187-147(240)111(70-200)192-150(243)122(77(9)202)195-142(235)102(55-80-26-16-13-17-27-80)188-149(242)121(76(8)201)193-116(210)66-168-126(219)93(41-44-112(156)206)175-144(237)108(67-197)189-125(218)88(155)59-84-65-164-71-169-84/h12-19,24-29,33-40,64-65,71-78,88,90-111,120-123,167,197-205H,20-23,30-32,41-63,66-70,154-155H2,1-11H3,(H2,156,206)(H2,157,207)(H2,158,208)(H2,159,209)(H,164,169)(H,168,219)(H,170,220)(H,171,217)(H,172,221)(H,173,238)(H,174,239)(H,175,237)(H,176,226)(H,177,241)(H,178,228)(H,179,230)(H,180,222)(H,181,232)(H,182,231)(H,183,224)(H,184,225)(H,185,223)(H,186,227)(H,187,240)(H,188,242)(H,189,218)(H,190,229)(H,191,233)(H,192,243)(H,193,210)(H,194,234)(H,195,235)(H,196,236)(H,211,212)(H,213,214)(H,215,216)(H,244,245)(H4,160,161,165)(H4,162,163,166)/t75-,76+,77+,78+,88-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,120-,121-,122-,123-/m0/s1
Chemical Name
(3S)-3-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S,3R)-2-[[2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-amino-3-(1H-imidazol-5-yl)propanoyl]amino]-3-hydroxypropanoyl]amino]-5-oxopentanoyl]amino]acetyl]amino]-3-hydroxybutanoyl]amino]-3-phenylpropanoyl]amino]-3-hydroxybutanoyl]amino]-3-hydroxypropanoyl]amino]-3-carboxypropanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-hydroxypropanoyl]amino]hexanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-4-methylpentanoyl]amino]-3-carboxypropanoyl]amino]-3-hydroxypropanoyl]amino]-5-carbamimidamidopentanoyl]amino]-5-carbamimidamidopentanoyl]amino]propanoyl]amino]-5-oxopentanoyl]amino]-4-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-4-amino-1-[[(1S,2R)-1-carboxy-2-hydroxypropyl]amino]-1,4-dioxobutan-2-yl]amino]-4-methylsulfanyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-4-oxobutanoic acid
Synonyms
Glucagon
HS Tariff Code
2934.99.9001
Storage

Powder      -20°C    3 years

                     4°C     2 years

In solvent   -80°C    6 months

                  -20°C    1 month

Note: Please store this product in a sealed and protected environment (e.g. under nitrogen), avoid exposure to moisture and light.
Shipping Condition
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
Solubility Data
Solubility (In Vitro)
H2O: 25 mg/mL
Solubility (In Vivo)
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.

Injection Formulations
(e.g. IP/IV/IM/SC)
Injection Formulation 1: DMSO : Tween 80: Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution 50 μL Tween 80 850 μL Saline)
*Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution.
Injection Formulation 2: DMSO : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO 400 μLPEG300 50 μL Tween 80 450 μL Saline)
Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO 900 μL Corn oil)
Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals).
View More

Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO 900 μL (20% SBE-β-CD in saline)]
*Preparation of 20% SBE-β-CD in Saline (4°C,1 week): Dissolve 2 g SBE-β-CD in 10 mL saline to obtain a clear solution.
Injection Formulation 5: 2-Hydroxypropyl-β-cyclodextrin : Saline = 50 : 50 (i.e. 500 μL 2-Hydroxypropyl-β-cyclodextrin 500 μL Saline)
Injection Formulation 6: DMSO : PEG300 : castor oil : Saline = 5 : 10 : 20 : 65 (i.e. 50 μL DMSO 100 μLPEG300 200 μL castor oil 650 μL Saline)
Injection Formulation 7: Ethanol : Cremophor : Saline = 10: 10 : 80 (i.e. 100 μL Ethanol 100 μL Cremophor 800 μL Saline)
Injection Formulation 8: Dissolve in Cremophor/Ethanol (50 : 50), then diluted by Saline
Injection Formulation 9: EtOH : Corn oil = 10 : 90 (i.e. 100 μL EtOH 900 μL Corn oil)
Injection Formulation 10: EtOH : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL EtOH 400 μLPEG300 50 μL Tween 80 450 μL Saline)


Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium)
Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose
Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals).
View More

Oral Formulation 3: Dissolved in PEG400
Oral Formulation 4: Suspend in 0.2% Carboxymethyl cellulose
Oral Formulation 5: Dissolve in 0.25% Tween 80 and 0.5% Carboxymethyl cellulose
Oral Formulation 6: Mixing with food powders


Note: Please be aware that the above formulations are for reference only. InvivoChem strongly recommends customers to read literature methods/protocols carefully before determining which formulation you should use for in vivo studies, as different compounds have different solubility properties and have to be formulated differently.

 (Please use freshly prepared in vivo formulations for optimal results.)
Preparing Stock Solutions 1 mg 5 mg 10 mg
1 mM 0.2871 mL 1.4356 mL 2.8713 mL
5 mM 0.0574 mL 0.2871 mL 0.5743 mL
10 mM 0.0287 mL 0.1436 mL 0.2871 mL

*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.

Calculator

Molarity Calculator allows you to calculate the mass, volume, and/or concentration required for a solution, as detailed below:

  • Calculate the Mass of a compound required to prepare a solution of known volume and concentration
  • Calculate the Volume of solution required to dissolve a compound of known mass to a desired concentration
  • Calculate the Concentration of a solution resulting from a known mass of compound in a specific volume
An example of molarity calculation using the molarity calculator is shown below:
What is the mass of compound required to make a 10 mM stock solution in 5 ml of DMSO given that the molecular weight of the compound is 350.26 g/mol?
  • Enter 350.26 in the Molecular Weight (MW) box
  • Enter 10 in the Concentration box and choose the correct unit (mM)
  • Enter 5 in the Volume box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 17.513 mg appears in the Mass box. In a similar way, you may calculate the volume and concentration.

Dilution Calculator allows you to calculate how to dilute a stock solution of known concentrations. For example, you may Enter C1, C2 & V2 to calculate V1, as detailed below:

What volume of a given 10 mM stock solution is required to make 25 ml of a 25 μM solution?
Using the equation C1V1 = C2V2, where C1=10 mM, C2=25 μM, V2=25 ml and V1 is the unknown:
  • Enter 10 into the Concentration (Start) box and choose the correct unit (mM)
  • Enter 25 into the Concentration (End) box and select the correct unit (mM)
  • Enter 25 into the Volume (End) box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 62.5 μL (0.1 ml) appears in the Volume (Start) box
g/mol

Molecular Weight Calculator allows you to calculate the molar mass and elemental composition of a compound, as detailed below:

Note: Chemical formula is case sensitive: C12H18N3O4  c12h18n3o4
Instructions to calculate molar mass (molecular weight) of a chemical compound:
  • To calculate molar mass of a chemical compound, please enter the chemical/molecular formula and click the “Calculate’ button.
Definitions of molecular mass, molecular weight, molar mass and molar weight:
  • Molecular mass (or molecular weight) is the mass of one molecule of a substance and is expressed in the unified atomic mass units (u). (1 u is equal to 1/12 the mass of one atom of carbon-12)
  • Molar mass (molar weight) is the mass of one mole of a substance and is expressed in g/mol.
/

Reconstitution Calculator allows you to calculate the volume of solvent required to reconstitute your vial.

  • Enter the mass of the reagent and the desired reconstitution concentration as well as the correct units
  • Click the “Calculate” button
  • The answer appears in the Volume (to add to vial) box
In vivo Formulation Calculator (Clear solution)
Step 1: Enter information below (Recommended: An additional animal to make allowance for loss during the experiment)
Step 2: Enter in vivo formulation (This is only a calculator, not the exact formulation for a specific product. Please contact us first if there is no in vivo formulation in the solubility section.)
+
+
+

Calculation results

Working concentration mg/mL;

Method for preparing DMSO stock solution mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.

Method for preparing in vivo formulation:Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O,mix and clarify.

(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
             (2) Be sure to add the solvent(s) in order.

Clinical Trial Information
The Effect of Glucagon on Rates of Hepatic Mitochondrial Oxidation in Man Assessed by PINTA
CTID: NCT03965130
Phase: Phase 1    Status: Completed
Date: 2024-11-26
Research Study in Japan to Compare Dasiglucagon With Glucagon in Treating Very Low Levels of Blood Sugar in Asian Adults With Type 1 Diabetes and Testing of Dasiglucagon for the Same Condition in Japanese Adolescents
CTID: NCT06588504
Phase: Phase 1    Status: Recruiting
Date: 2024-10-01
Human Models of Selective Insulin Resistance: Pancreatic Clamp
CTID: NCT06558422
Phase: Phase 1    Status: Not yet recruiting
Date: 2024-09-20
Pancreatic Clamp in NAFLD
CTID: NCT05724134
Phase: Phase 1    Status: Recruiting
Date: 2024-09-19
Effect of Prolonged (72 Hour) Glucagon Administration on Energy Expenditure in Healthy Obese Subjects
CTID: NCT03139305
Phase: Phase 1    Status: Active, not recruiting
Date: 2024-08-05
View More

To Determine Tolerability to Glucagon Infusion in Obese Subjects
CTID: NCT02817659
Phase: Phase 1    Status: Active, not recruiting
Date: 2024-08-05


Dexamethasone/Pancreatic Clamp P&F
CTID: NCT06126354
Phase: Phase 1    Status: Withdrawn
Date: 2024-07-10
Haemodynamic Effects of GLP-1 and Glucagon in Healthy Male Volunteers
CTID: NCT03835013
Phase: N/A    Status: Completed
Date: 2024-04-03
Liver Glycogen and Hypoglycemia in Humans
CTID: NCT03241706
Phase: Phase 1    Status: Active, not recruiting
Date: 2024-02-28
Value of PET/MR Enterography in the Assessment of Crohn's Disease Using a Collagen-binding Radiotracer.
CTID: NCT06252493
Phase:    Status: Recruiting
Date: 2024-02-12
Glucagon Enhanced Insulin Absorption in Diabetes Mellitus Type 1
CTID: NCT05960565
Phase: Phase 2    Status: Recruiting
Date: 2023-07-25
The Effect of Lifestyle-induced Hepatic Steatosis on Glucagon-stimulated Amino Acid Turnover
CTID: NCT04859322
Phase: N/A    Status: Completed
Date: 2023-05-11
Metabolic Adaptation to High-frequent Hypoglycaemia in Type 1 Diabetes
CTID: NCT05095259
Phase: N/A    Status: Active, not recruiting
Date: 2023-05-03
Closed-Loop Glucagon Pump for Treatment of Post-Bariatric Hypoglycemia
CTID: NCT03255629
Phase: Phase 1/Phase 2    Status: Completed
Date: 2022-09-06
Dual-hormone Closed-loop Glucose Control in Type 1 Diabetes
CTID: NCT04053712
Phase: Phase 4    Status: Completed
Date: 2022-08-18
Dual-Hormone Closed-Loop Glucose Control in Adolescents With Type 1 Diabetes
CTID: NCT04949867
Phase: Phase 4    Status: Completed
Date: 2022-08-18
In Vivo Assessment of Cellular Metabolism in Humans
CTID: NCT02748369
Phase: Phase 1    Status: Completed
Date: 2022-08-03
A Study to Demonstrate Bioequivalence Between Insulin Glulisine U300 and Insulin Glulisine U100 After a Single Subcutaneous Dose Using the Euglycemic Clamp Technique, in Patients With Type 1 Diabetes Mellitus
CTID: NCT02910518
Phase: Phase 1 Status:
G-PEN (GLUCAGON INJECTION) COMPARED TO GLUCAGEN® HYPOKIT® (GLUCAGON) FOR INDUCED HYPOGLYCEMIA RESCUE IN ADULTS WITH T1D: A PHASE 3 MULTI-CENTER, RANDOMIZED, CONTROLLED, SINGLE BLIND, 2-WAY CROSSOVER STUDY TO EVALUATE EFFICACY AND SAFETY
CTID: null
Phase: Phase 3    Status: Completed
Date: 2019-03-13
A phase 3, randomized, double-blind, placebo- and active-controlled, parallel-arm trial to assess the efficacy, safety, and pharmacokinetics of dasiglucagon relative to placebo and GlucaGen® when administered as a rescue therapy for severe hypoglycemia in children with T1DM treated with insulin
CTID: null
Phase: Phase 3    Status: Completed
Date: 2019-01-29
A phase 3, randomized, double-blind, parallel trial to confirm the clinical efficacy and safety of dasiglucagon in the rescue treatment of hypoglycemia in subjects with type 1 diabetes mellitus (T1DM) compared to placebo and with reference to GlucaGen®
CTID: null
Phase: Phase 3    Status: Completed
Date: 2018-02-16
A phase 3, Randomized, Double-Blind, Parallel Group Safety Trial to Evaluate the Immunogenicity of Dasiglucagon And GlucaGen® Administered Subcutaneously in Patients with Type 1 Diabetes Mellitus (T1DM)
CTID: null
Phase: Phase 3    Status: Completed
Date: 2017-05-29
A randomised, sequential, cross-over trial assessing pharmacokinetic and pharmacodynamic responses after micro-doses of ZP4207 administered subcutaneously to patients with type 1 diabetes mellitus under euglycaemic and hypoglycaemic conditions and with reference to freshly reconstituted lyophilized glucagon
CTID: null
Phase: Phase 2    Status: Completed
Date: 2016-11-28
A randomized, double-blind trial of single doses of ZP4207 administered s.c. to hypoglycemic Type 1 diabetic patients to describe the pharmacokinetics and pharmacodynamics of ZP4207 as compared to marketed glucagon
CTID: null
Phase: Phase 2    Status: Completed
Date: 2016-01-20
Combining Glucagon and Insulin Infusion with Glucose Sensing in Subcutaneous Adipose Tissue of Type 1 Diabetes Patients
CTID: null
Phase: Phase 4    Status: Completed
Date: 2015-07-14
Assessment of the Duration of Glucagon’s Waning Effect on the Hepatic Glucose Production in Type 1 Diabetes Patients
CTID: null
Phase: Phase 4    Status: Completed
Date: 2015-03-23
Dual-Hormone Closed-Loop Glucose Control in Type 1 Diabetes
CTID: null
Phase: Phase 4    Status: Prematurely Ended
Date: 2014-11-20
Treatment of hypoglycemia with glucagon among patients with type 1 diabetes mellitus
CTID: null
Phase: Phase 4    Status: Completed
Date: 2014-07-31
Evaluation of the Effect of Glucagon Solutions on the Glucose Concentration at the Subcutaneous Administration Site in Type 1 Diabetic Patients.
CTID: null
Phase: Phase 4    Status: Completed
Date: 2014-07-11
Assessment of Hepatic Glucose Production Following Repeated Glucagon Administration in Type 1 Diabetes Patients
CTID: null
Phase: Phase 4    Status: Completed
Date: 2013-06-04
Randomized study evaluating antiperistaltic effect of L-menthol sprayed onto the colonic mucosa for colonic endoscopic mucosal resection in patients with underlying disease
CTID: UMIN000007984
Phase: Phase III    Status: Complete: follow-up complete
Date: 2012-05-18
The evaluation of usefulness of peppermint oil solution as an antispasmodic drug for esophagogastroduodenoscopy.
CTID: UMIN000004710
Phase:    Status: Complete: follow-up complete
Date: 2010-12-12

Contact Us