yingweiwo

Biotinyl-Amylin (mouse, rat) TFA

Cat No.:V106351 Purity: ≥98%
Biotin-Amylin (mouse, rat) TFA is a biotinylated version of Amylin (mouse, rat).
Biotinyl-Amylin (mouse, rat) TFA
Biotinyl-Amylin (mouse, rat) TFA Chemical Structure Product category: Others 16
This product is for research use only, not for human use. We do not sell to patients.
Size Price Stock Qty
1mg
Other Sizes
Official Supplier of:
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text

 

  • Business Relationship with 5000+ Clients Globally
  • Major Universities, Research Institutions, Biotech & Pharma
  • Citations by Top Journals: Nature, Cell, Science, etc.
Top Publications Citing lnvivochem Products
Product Description
Biotinyl-Amylin (mouse, rat) TFA is a biotinylated Amylin (mouse, rat). Amylin (mouse, rat) is a 37 amino acid pancreatic protein that controls multiple metabolic events including glycemia and lactic acidosis.
Biotinyl-Amylin (mouse, rat) TFA is a biotinylated form of the mouse/rat amylin peptide (sequence KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2, disulfide bridge: Cys2-Cys7). It consists of 37 amino acids, and its molecular weight (free base) is 4146.69 Da. Biotinylation is typically at the N-terminus. This biotin-labeled analog retains the biological activity of native amylin and serves as a high-affinity probe for studying amylin receptors and for detecting amylin in various assays.
Biological Activity I Assay Protocols (From Reference)
Targets
Biotinyl-Amylin (mouse, rat) TFA targets the amylin receptor, a complex of the calcitonin receptor (CTR) with receptor activity-modifying proteins (RAMPs). Amylin is a pancreatic hormone co-secreted with insulin. It plays a crucial role in glucose metabolism by regulating gastric emptying, suppressing glucagon secretion, and promoting satiety. The biotinyl group does not interfere with the receptor binding properties of the peptide. In fact, biotinyl analogues of amylin retain a similar affinity for binding to rat liver plasma membranes compared to rat amylin.
ln Vitro
In vitro, Biotinyl-Amylin (mouse, rat) TFA is used as a probe to study amylin receptor binding and expression. Biotinyl analogues of amylin retain similar affinity for binding to rat liver plasma membranes compared to rat amylin. In functional assays, this biotinylated peptide completely inhibits insulin-stimulated glycogen synthesis in rat soleus muscle incubated in vitro, demonstrating that the biotin label does not impair its biological activity. This biotinylated form is ideal for pull-down assays, ELISA, and flow cytometry.
ln Vivo
In vivo, the parent peptide, amylin, is a 37-amino acid pancreatic protein that controls several metabolic events such as glycemia and lacticemia. Biotinyl-Amylin (mouse, rat) TFA is primarily a tool for ex vivo or in vitro applications. It can be used in animal models to track the distribution of amylin or to study its binding to tissues, but this typically requires injection of the labeled peptide. The biotin tag allows for detection with streptavidin-conjugated probes (e.g., HRP, fluorophores) in histochemical or biochemical assays.
Enzyme Assay
The binding affinity of Biotinyl-Amylin for its receptor can be assessed by a competitive binding assay. Rat liver plasma membranes (RLPM) are prepared and incubated with varying concentrations (0.01-1000 nM) of Biotinyl-Amylin TFA in the presence or absence of excess unlabeled amylin. After incubation and washing, the bound Biotinyl-Amylin is detected using a streptavidin-conjugated HRP and a colorimetric substrate (e.g., TMB). The absorbance at 450 nm is measured, and the specific binding is calculated. The dissociation constant (Kd) can be determined from saturation binding experiments.
Cell Assay
Biotinyl-Amylin (mouse, rat) TFA is not used in standard cell viability assays. Instead, it is used for receptor binding studies. Cells expressing the amylin receptor (e.g., NIH-3T3 cells transfected with CTR and RAMP3) are seeded in 24-well plates. The cells are incubated with varying concentrations of Biotinyl-Amylin TFA (0.1-1000 nM) in binding buffer. Non-specific binding is determined in the presence of a 100-fold excess of unlabeled amylin. After incubation and washing, the cells are lysed, and the bound biotinylated peptide is detected by a streptavidin-HRP ELISA. The binding affinity (Kd) is calculated from saturation binding curves.
Animal Protocol
Amylin has been shown to induce hypoglycemia in mice. For in vivo studies, the biotinylated form can be used for histochemical detection. Male C57BL/6 mice (n=6/group) are injected intraperitoneally (IP) or intravenously (IV) with Biotinyl-Amylin (mouse, rat) TFA (10-50 ug). Control groups receive vehicle or unlabeled amylin. At defined intervals, the mice are sacrificed, and tissues (e.g., brain, pancreas, stomach, kidney) are harvested. Tissue sections are prepared and stained with streptavidin-conjugated fluorophores or HRP to visualize the distribution of the injected biotinylated peptide. This allows for the direct mapping of amylin binding sites.
ADME/Pharmacokinetics
Biotinyl-Amylin (mouse, rat) TFA (MW 4146.69) is a peptide. As a biotinylated peptide, it is metabolically stable for limited time periods in vitro, but in vivo it would be subject to rapid proteolytic degradation. The biotin label is not chemically altered by metabolic processes. It is typically stored as a lyophilized powder at -20degC or -80degC. For research use, it is reconstituted in water, PBS, or buffer containing carrier protein (e.g., 0.1% BSA) to prevent adsorption to surfaces. No detailed PK data is available.
Toxicity/Toxicokinetics
Standard safety precautions for handling peptides apply. Biotinyl-Amylin (mouse, rat) TFA is for research use only and is not intended for human consumption. It may cause skin and eye irritation. For handling, use personal protective equipment (gloves, lab coat, eye protection), work in a fume hood, avoid inhalation and skin contact.
References

[1]. Amylin induces hypoglycemia in mice. An Acad Bras Cienc. 2013 Mar;85(1):349-54.

Additional Infomation
Biotinyl-Amylin (mouse, rat) TFA is a research-grade biotinylated peptide used as a high-affinity probe for amylin receptors. It is not an FDA-approved drug. It is a valuable tool for studying amylin binding, receptor expression, and its role in metabolic diseases such as diabetes and obesity. For research use only, not for diagnostic or therapeutic applications. Storage: powder at -20degC for 3 years, 4degC for 2 years; in solvent at -80degC for 1 year.
These protocols are for reference only. InvivoChem does not independently validate these methods.
Physicochemical Properties
Molecular Formula
C177H286N54O55S3.XC2HF3O2
Molecular Weight
4146.69 (free base)
Appearance
Solid powder
HS Tariff Code
2934.99.9001
Storage

Powder      -20°C    3 years

                     4°C     2 years

In solvent   -80°C    6 months

                  -20°C    1 month

Note: Please store this product in a sealed and protected environment (e.g. under nitrogen), avoid exposure to moisture and light.
Shipping Condition
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
Solubility Data
Solubility (In Vitro)
H2O : ~50 mg/mL (with ultrasonication)
Solubility (In Vivo)
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.

Injection Formulations
(e.g. IP/IV/IM/SC)
Injection Formulation 1: DMSO : Tween 80: Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution 50 μL Tween 80 850 μL Saline)
*Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution.
Injection Formulation 2: DMSO : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO 400 μLPEG300 50 μL Tween 80 450 μL Saline)
Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO 900 μL Corn oil)
Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals).
View More

Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO 900 μL (20% SBE-β-CD in saline)]
*Preparation of 20% SBE-β-CD in Saline (4°C,1 week): Dissolve 2 g SBE-β-CD in 10 mL saline to obtain a clear solution.
Injection Formulation 5: 2-Hydroxypropyl-β-cyclodextrin : Saline = 50 : 50 (i.e. 500 μL 2-Hydroxypropyl-β-cyclodextrin 500 μL Saline)
Injection Formulation 6: DMSO : PEG300 : castor oil : Saline = 5 : 10 : 20 : 65 (i.e. 50 μL DMSO 100 μLPEG300 200 μL castor oil 650 μL Saline)
Injection Formulation 7: Ethanol : Cremophor : Saline = 10: 10 : 80 (i.e. 100 μL Ethanol 100 μL Cremophor 800 μL Saline)
Injection Formulation 8: Dissolve in Cremophor/Ethanol (50 : 50), then diluted by Saline
Injection Formulation 9: EtOH : Corn oil = 10 : 90 (i.e. 100 μL EtOH 900 μL Corn oil)
Injection Formulation 10: EtOH : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL EtOH 400 μLPEG300 50 μL Tween 80 450 μL Saline)


Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium)
Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose
Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals).
View More

Oral Formulation 3: Dissolved in PEG400
Oral Formulation 4: Suspend in 0.2% Carboxymethyl cellulose
Oral Formulation 5: Dissolve in 0.25% Tween 80 and 0.5% Carboxymethyl cellulose
Oral Formulation 6: Mixing with food powders


Note: Please be aware that the above formulations are for reference only. InvivoChem strongly recommends customers to read literature methods/protocols carefully before determining which formulation you should use for in vivo studies, as different compounds have different solubility properties and have to be formulated differently.

 (Please use freshly prepared in vivo formulations for optimal results.)
Calculator

Molarity Calculator allows you to calculate the mass, volume, and/or concentration required for a solution, as detailed below:

  • Calculate the Mass of a compound required to prepare a solution of known volume and concentration
  • Calculate the Volume of solution required to dissolve a compound of known mass to a desired concentration
  • Calculate the Concentration of a solution resulting from a known mass of compound in a specific volume
An example of molarity calculation using the molarity calculator is shown below:
What is the mass of compound required to make a 10 mM stock solution in 5 ml of DMSO given that the molecular weight of the compound is 350.26 g/mol?
  • Enter 350.26 in the Molecular Weight (MW) box
  • Enter 10 in the Concentration box and choose the correct unit (mM)
  • Enter 5 in the Volume box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 17.513 mg appears in the Mass box. In a similar way, you may calculate the volume and concentration.

Dilution Calculator allows you to calculate how to dilute a stock solution of known concentrations. For example, you may Enter C1, C2 & V2 to calculate V1, as detailed below:

What volume of a given 10 mM stock solution is required to make 25 ml of a 25 μM solution?
Using the equation C1V1 = C2V2, where C1=10 mM, C2=25 μM, V2=25 ml and V1 is the unknown:
  • Enter 10 into the Concentration (Start) box and choose the correct unit (mM)
  • Enter 25 into the Concentration (End) box and select the correct unit (mM)
  • Enter 25 into the Volume (End) box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 62.5 μL (0.1 ml) appears in the Volume (Start) box
g/mol

Molecular Weight Calculator allows you to calculate the molar mass and elemental composition of a compound, as detailed below:

Note: Chemical formula is case sensitive: C12H18N3O4  c12h18n3o4
Instructions to calculate molar mass (molecular weight) of a chemical compound:
  • To calculate molar mass of a chemical compound, please enter the chemical/molecular formula and click the “Calculate’ button.
Definitions of molecular mass, molecular weight, molar mass and molar weight:
  • Molecular mass (or molecular weight) is the mass of one molecule of a substance and is expressed in the unified atomic mass units (u). (1 u is equal to 1/12 the mass of one atom of carbon-12)
  • Molar mass (molar weight) is the mass of one mole of a substance and is expressed in g/mol.
/

Reconstitution Calculator allows you to calculate the volume of solvent required to reconstitute your vial.

  • Enter the mass of the reagent and the desired reconstitution concentration as well as the correct units
  • Click the “Calculate” button
  • The answer appears in the Volume (to add to vial) box
In vivo Formulation Calculator (Clear solution)
Step 1: Enter information below (Recommended: An additional animal to make allowance for loss during the experiment)
Step 2: Enter in vivo formulation (This is only a calculator, not the exact formulation for a specific product. Please contact us first if there is no in vivo formulation in the solubility section.)
+
+
+

Calculation results

Working concentration mg/mL;

Method for preparing DMSO stock solution mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.

Method for preparing in vivo formulation:Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O,mix and clarify.

(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
             (2) Be sure to add the solvent(s) in order.

Contact Us