| Size | Price | Stock | Qty |
|---|---|---|---|
| 1mg |
|
||
| 5mg |
|
||
| 10mg |
|
||
| 100mg | |||
| Other Sizes |
| Targets |
Cecropin A targets the cell membranes of bacteria, fungi, and cancer cells. As a cationic peptide, it interacts with the negatively charged components of microbial and cancer cell membranes. This interaction leads to the formation of pores in the membrane, causing membrane depolarization, leakage of intracellular contents, and cell death. Its anticancer activity is attributed to its ability to disrupt the membranes of cancer cells.
|
|---|---|
| ln Vitro |
There is anticancer action in cecropin A. The viability of HL-60 cells is dose-dependently decreased by cecropin A (10–50 μM). In HL-60 cells, cecropin A (30 μM) increases the formation of reactive oxygen species (ROS), which collapses the mitochondrial membrane potential (Δψm) and alters the morphology of the nuclear chromatin. In HL-60 cells, cecropin A (30 μM) similarly induces early apoptosis and results in caspase-independent cell death [1]. With a minimum inhibitory concentration (MIC) of 0.5-1 μM, cecropin A is cytotoxic to Gram-negative bacteria, including Acinetobacter baumannii (CCARM 12005, CCARM 12035, CCARM 12036, and CCARM 12037). In RAW264.7 cells, cecropin A (25 μM) mildly suppressed the expression of mMIP-1 mRNA and considerably hindered the expression of mTNF-α, mIL-1β, and mMIP-2 mRNA. Cecropin A (0.1, 0.25, 0.5, 1, 2.5, and 5 μM) exhibits anti-inflammatory properties and can also suppress the formation of NO and lower mTNF-α cytokine levels in LPS-stimulated RAW264.7 cells [2].
In vitro, Cecropin A exhibits antibacterial, antitumor, and anti-inflammatory effects. It has a wide spectrum of antimicrobial activities against various bacteria and fungi. Its mechanism of action involves pore formation in microbial membranes. Quantitative IC50 values for its antimicrobial and anticancer activities are not detailed in the publicly available sources. |
| ln Vivo |
In vivo activity data for Cecropin A is limited in publicly available literature. As an antimicrobial and anticancer peptide with potent in vitro activity, it is hypothesized to exhibit similar effects in animal models. However, specific in vivo efficacy studies, including pharmacokinetic and pharmacodynamic parameters, have not been detailed in the available sources. Its potential as a therapeutic agent is being explored.
|
| Enzyme Assay |
For in vitro cell-free assays, the interaction of Cecropin A with model membranes can be studied using techniques such as surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC). The ability of the peptide to form pores in liposomes or artificial membranes can be assessed by measuring the release of encapsulated fluorescent dyes. These assays provide insights into its membrane-disrupting mechanism.
|
| Cell Assay |
For in vitro cellular assays, the antimicrobial activity of Cecropin A is assessed in bacterial or fungal cultures using standard broth microdilution methods to determine the MIC. Its anticancer activity is assessed in cancer cell lines by measuring cell viability using MTT or SRB assays. Its anti-inflammatory activity can be assessed in immune cells by measuring cytokine production.
|
| Animal Protocol |
For in vivo studies, Cecropin A could be administered intravenously, intraperitoneally, or topically in animal models of bacterial infection or cancer. The reduction in microbial load, tumor growth inhibition, and survival rate are typical endpoints.
|
| ADME/Pharmacokinetics |
Cecropin A has a molecular formula of C184H313N53O46 and a molecular weight of 4003.78 g/mol. Its CAS number is 80451-04-3. It is a linear 37-residue peptide and is typically supplied as a lyophilized powder. It is soluble in water and buffers. For in vitro studies, it is dissolved in water or buffer. For in vivo administration, it can be formulated in suitable vehicles. Storage is recommended at -20°C, protected from light. Its purity is typically >99% for research use.
|
| Toxicity/Toxicokinetics |
No detailed toxicity data is publicly available. As an antimicrobial peptide, its toxicity would need to be established through standard toxicological studies. Its selectivity for microbial and cancer cell membranes over normal mammalian membranes is a key factor in its safety profile.
|
| References | |
| Additional Infomation |
Cecropin A is a research-grade compound and is not approved for any therapeutic use. It serves primarily as a valuable tool for studying antimicrobial peptides, membrane biology, and innate immunity. Its mechanism of action involves pore formation in membranes. Its broad-spectrum antimicrobial and anticancer activities make it a compound of interest for drug discovery. No clinical trials have been reported.
|
| Molecular Formula |
C184H313N53O46
|
|---|---|
| Molecular Weight |
4003.78156161308
|
| Exact Mass |
4002.381
|
| CAS # |
80451-04-3
|
| Related CAS # |
Cecropin A TFA
|
| PubChem CID |
16132345
|
| Sequence |
H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2
Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 L-lysyl-L-tryptophyl-L-lysyl-L-leucyl-L-phenylalanyl-L-lysyl-L-lysyl-L-isoleucyl-L-alpha-glutamyl-L-lysyl-L-valyl-glycyl-L-glutaminyl-L-asparagyl-L-isoleucyl-L-arginyl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-isoleucyl-L-lysyl-L-alanyl-glycyl-L-prolyl-L-alanyl-L-valyl-L-alanyl-L-valyl-L-valyl-glycyl-L-glutaminyl-L-alanyl-L-threonyl-L-glutaminyl-L-isoleucyl-L-alanyl-L-lysinamide |
| SequenceShortening |
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 |
| Appearance |
White to off-white solid powder
|
| LogP |
-10.7
|
| Hydrogen Bond Donor Count |
55
|
| Hydrogen Bond Acceptor Count |
55
|
| Rotatable Bond Count |
142
|
| Heavy Atom Count |
283
|
| Complexity |
9430
|
| Defined Atom Stereocenter Count |
39
|
| SMILES |
O=C([C@@H]1CCCN1C(CNC([C@H](C)NC([C@H](CCCCN)NC([C@H]([C@@H](C)CC)NC([C@H]([C@@H](C)CC)NC(CNC([C@H](CC(=O)O)NC([C@H](CCCNC(=N)N)NC([C@H]([C@@H](C)CC)NC([C@H](CC(N)=O)NC([C@H](CCC(N)=O)NC(CNC([C@H](C(C)C)NC([C@H](CCCCN)NC([C@H](CCC(=O)O)NC([C@H]([C@@H](C)CC)NC([C@H](CCCCN)NC([C@H](CCCCN)NC([C@H](CC1C=CC=CC=1)NC([C@H](CC(C)C)NC([C@H](CCCCN)NC([C@H](CC1=CNC2C=CC=CC1=2)NC([C@H](CCCCN)N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)N[C@@H](C)C(N[C@H](C(N[C@@H](C)C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@@H](C)C(N[C@@H]([C@@H](C)O)C(N[C@@H](CCC(N)=O)C(N[C@H](C(N[C@@H](C)C(N[C@H](C(N)=O)CCCCN)=O)=O)[C@@H](C)CC)=O)=O)=O)=O)CCC(N)=O)=O)=O)C(C)C)=O)C(C)C)=O)=O)C(C)C)=O
|
| InChi Key |
HCQPHKMLKXOJSR-IRCPFGJUSA-N
|
| InChi Code |
InChI=1S/C184H313N53O46/c1-27-98(16)145(182(282)235-149(102(20)31-5)181(281)218-115(59-39-46-76-187)159(259)206-103(21)152(252)205-92-138(246)237-82-52-65-130(237)173(273)208-106(24)154(254)228-143(96(12)13)176(276)209-107(25)155(255)229-144(97(14)15)177(277)231-142(95(10)11)175(275)204-89-135(243)211-121(66-70-131(193)239)160(260)207-105(23)156(256)236-150(108(26)238)183(283)221-123(68-72-133(195)241)168(268)232-146(99(17)28-2)178(278)210-104(22)153(253)213-114(151(197)251)58-38-45-75-186)227-137(245)91-202-158(258)129(87-140(249)250)226-163(263)120(64-51-81-200-184(198)199)219-179(279)148(101(19)30-4)234-172(272)128(86-134(196)242)225-164(264)122(67-71-132(194)240)212-136(244)90-203-174(274)141(94(8)9)230-166(266)118(62-42-49-79-190)215-165(265)124(69-73-139(247)248)220-180(280)147(100(18)29-3)233-167(267)119(63-43-50-80-191)214-161(261)116(60-40-47-77-188)216-170(270)126(84-109-53-33-32-34-54-109)224-169(269)125(83-93(6)7)223-162(262)117(61-41-48-78-189)217-171(271)127(222-157(257)112(192)56-37-44-74-185)85-110-88-201-113-57-36-35-55-111(110)113/h32-36,53-55,57,88,93-108,112,114-130,141-150,201,238H,27-31,37-52,56,58-87,89-92,185-192H2,1-26H3,(H2,193,239)(H2,194,240)(H2,195,241)(H2,196,242)(H2,197,251)(H,202,258)(H,203,274)(H,204,275)(H,205,252)(H,206,259)(H,207,260)(H,208,273)(H,209,276)(H,210,278)(H,211,243)(H,212,244)(H,213,253)(H,214,261)(H,215,265)(H,216,270)(H,217,271)(H,218,281)(H,219,279)(H,220,280)(H,221,283)(H,222,257)(H,223,262)(H,224,269)(H,225,264)(H,226,263)(H,227,245)(H,228,254)(H,229,255)(H,230,266)(H,231,277)(H,232,268)(H,233,267)(H,234,272)(H,235,282)(H,236,256)(H,247,248)(H,249,250)(H4,198,199,200)/t98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108+,112-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-/m0/s1
|
| Chemical Name |
(4S)-5-[[(2S)-6-amino-1-[[(2S)-1-[[2-[[(2S)-5-amino-1-[[(2S)-4-amino-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[2-[[(2S,3S)-1-[[(2S,3S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[2-[(2S)-2-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[2-[[(2S)-5-amino-1-[[(2S)-1-[[(2S,3R)-1-[[(2S)-5-amino-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-1,6-diamino-1-oxohexan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-1-oxopropan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-2-oxoethyl]amino]-3-methyl-1-oxobutan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1-oxopropan-2-yl]carbamoyl]pyrrolidin-1-yl]-2-oxoethyl]amino]-1-oxopropan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-2-oxoethyl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-2-oxoethyl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1-oxohexan-2-yl]amino]-4-[[(2S,3S)-2-[[(2S)-6-amino-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]hexanoyl]amino]-4-methylpentanoyl]amino]-3-phenylpropanoyl]amino]hexanoyl]amino]hexanoyl]amino]-3-methylpentanoyl]amino]-5-oxopentanoic acid
|
| Synonyms |
Cecropin A; 80451-04-3; dsim protein, Drosophila; dyak protein, Drosophila; cecropin A1 protein, Drosophila;
|
| HS Tariff Code |
2934.99.9001
|
| Storage |
Powder -20°C 3 years 4°C 2 years In solvent -80°C 6 months -20°C 1 month Note: Please store this product in a sealed and protected environment, avoid exposure to moisture. |
| Shipping Condition |
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
|
| Solubility (In Vitro) |
H2O : ~20 mg/mL (~5.00 mM)
|
|---|---|
| Solubility (In Vivo) |
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.
Injection Formulations
Injection Formulation 1: DMSO : Tween 80： Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution → 50 μL Tween 80 → 850 μL Saline)(e.g. IP/IV/IM/SC) *Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution. Injection Formulation 2: DMSO : PEG300 ：Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO → 400 μLPEG300 → 50 μL Tween 80 → 450 μL Saline) Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO → 900 μL Corn oil) Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals). View More
Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO → 900 μL (20% SBE-β-CD in saline)] Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium) Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals). View More
Oral Formulation 3: Dissolved in PEG400 (Please use freshly prepared in vivo formulations for optimal results.) |
| Preparing Stock Solutions | 1 mg | 5 mg | 10 mg | |
| 1 mM | 0.2498 mL | 1.2488 mL | 2.4976 mL | |
| 5 mM | 0.0500 mL | 0.2498 mL | 0.4995 mL | |
| 10 mM | 0.0250 mL | 0.1249 mL | 0.2498 mL |
*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.
Calculation results
Working concentration： mg/mL；
Method for preparing DMSO stock solution： mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.
Method for preparing in vivo formulation:：Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O，mix and clarify.
(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
(2) Be sure to add the solvent(s) in order.
Products are for research use only; We do not sell to patients
Copyright 2020 InvivoChem LLC | All Rights Reserved
