yingweiwo

Adrenomedullin (AM) (22-52), human

Cat No.:V32538 Purity: ≥98%
Adrenomedullin (AM) (22-52), human, NH2 terminal truncated adrenomedullin analog, is an adrenomedullin (adrenomedullin receptor) receptor blocker (antagonist), and also inhibits calcitonin gene-related peptide in the cat hindlimb vascular bed.
Adrenomedullin (AM) (22-52), human
Adrenomedullin (AM) (22-52), human Chemical Structure CAS No.: 159899-65-7
Product category: New2
This product is for research use only, not for human use. We do not sell to patients.
Size Price Stock Qty
1mg
5mg
100mg
Other Sizes
Official Supplier of:
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text

 

  • Business Relationship with 5000+ Clients Globally
  • Major Universities, Research Institutions, Biotech & Pharma
  • Citations by Top Journals: Nature, Cell, Science, etc.
Top Publications Citing lnvivochem Products
Product Description
Adrenomedullin (AM) (22-52), human, NH2 terminal truncated adrenomedullin analog, is an adrenomedullin (adrenomedullin receptor) receptor blocker (antagonist), and also inhibits calcitonin gene-related peptide in the cat hindlimb vascular bed. (CGRP) receptors also have antagonistic effects.
Adrenomedullin (AM) (22-52), human (CAS 159899-65-7) is an NH2-terminal truncated analogue of adrenomedullin (ADM) that functions as an adrenomedullin receptor antagonist. With a molecular formula of C159H252N46O48 and a molecular weight of 3575.98, this 31-amino-acid peptide has the sequence TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2. It also antagonizes the calcitonin gene-related peptide (CGRP) receptor in the hindlimb vascular bed of the cat. The compound competitively inhibits the binding of adrenomedullin in a dose-dependent manner and inhibits adrenomedullin-induced cAMP accumulation in rat vascular smooth muscle cells.
Biological Activity I Assay Protocols (From Reference)
Targets
Adrenomedullin receptor and CGRP (calcitonin gene-related peptide) receptor. Adrenomedullin (AM) (22-52), human is an NH2-terminal truncated adrenomedullin analogue that acts as an adrenomedullin receptor antagonist. It also antagonizes the calcitonin gene-related peptide (CGRP) receptor in the hindlimb vascular bed of the cat. The peptide competitively inhibits the binding of adrenomedullin in a dose-dependent manner.
ln Vitro
Adrenomedullin (AM) (22-52), Humans have no influence on the hindlimb perfusion pressure response to 120 nmol adrenomedullin (ADM). However, human adrenomedullin (AM) (22-52) at 30 nmol specifically and reversibly decreases the vasodilatory response to human calcitonin gene-related peptide (hCGRP) with effects similar to those of CGRP antagonists [1]. Human adrenomedullin (AM) (22-52) competitively inhibits adrenomedullin binding in a dose-dependent manner and decreases adrenomedullin-induced cAMP buildup in rat vascular smooth muscle cells [1].
In vitro, Adrenomedullin (AM) (22-52), human shows no effect on hindlimb perfusion pressure responses to adrenomedullin (ADM) at 120 nmol. However, it selectively and reversibly decreases vasodilator responses to human calcitonin gene-related peptide (hCGRP) at 30 nmol, with a similar effect to that of a CGRP antagonist. The peptide competitively inhibits the binding of adrenomedullin in a dose-dependent manner and inhibits adrenomedullin-induced cAMP accumulation in rat vascular smooth muscle cells.
ln Vivo
In vivo, Adrenomedullin (AM) (22-52), human has been studied in animal models to characterize its antagonist effects. In the cat hindlimb vascular bed, the peptide antagonizes vasodilator responses to CGRP but not to adrenomedullin. It has been reported that 30 nmol of the peptide can selectively and reversibly decrease vasodilator responses to human CGRP. The compound is used as a research tool to study the physiological roles of adrenomedullin and CGRP in cardiovascular regulation.
Enzyme Assay
In vitro receptor binding assays for Adrenomedullin (AM) (22-52), human measure its affinity for adrenomedullin and CGRP receptors. The assay uses membrane preparations from cells expressing recombinant adrenomedullin or CGRP receptors and a radiolabeled ligand. Varying concentrations of the peptide are incubated with membranes and radioligand. Non-specific binding is determined in the presence of excess unlabeled ligand. After incubation, bound and free radioligands are separated by filtration, and radioactivity is counted. IC50 and Ki values are calculated from competition curves using nonlinear regression analysis.
Cell Assay
In vitro cell-based assays for Adrenomedullin (AM) (22-52), human use rat vascular smooth muscle cells or cells expressing adrenomedullin receptors. Cells are seeded in multi-well plates and pre-incubated with varying concentrations of the peptide antagonist for 30-60 minutes, followed by stimulation with a fixed concentration of adrenomedullin. Functional readouts include cAMP accumulation measured by ELISA or HTRF. Antagonist potency is expressed as IC50 or pKB values. The reversible nature of the antagonist allows for washout experiments to confirm competitive binding kinetics.
Animal Protocol
In vivo animal studies with Adrenomedullin (AM) (22-52), human are commonly conducted in cat or rat models. A typical protocol involves intravenous administration of the peptide at doses ranging from 10-120 nmol, followed by assessment of hemodynamic parameters such as hindlimb perfusion pressure. Vasodilator responses to adrenomedullin and CGRP are measured before and after peptide administration. Blood pressure, heart rate, and vascular resistance are monitored at various time points post-administration.
ADME/Pharmacokinetics
Pharmacokinetic properties of Adrenomedullin (AM) (22-52), human are characteristic of peptide antagonists. With a molecular weight of 3575.98 and a 31-amino-acid sequence, the peptide is susceptible to proteolytic degradation and has a short half-life in biological fluids. It is soluble in DMSO (100 mg/mL) and water (50 mg/mL). The peptide is typically stored as a powder at -80degC for up to 2 years or at -20degC for up to 1 year. In solution, it should be stored at -80degC for up to 6 months or at -20degC for up to 1 month.
Toxicity/Toxicokinetics
Adrenomedullin (AM) (22-52), human is intended for research use only and is not for human therapeutic use. As a peptide antagonist, it is generally well-tolerated at pharmacological doses in animal studies. Standard safety precautions for handling peptides apply. The compound is not approved for clinical use.
References

[1]. Adrenomedullin-(22-52) antagonizes vasodilator responses to CGRP but not adrenomedullin in the cat. Am J Physiol. 1997 Jan;272(1 Pt 2):R234-42.

[2]. Effects of adrenomedullin and its fragment 22-52 on basal and ACTH-stimulated secretion of cultured rat adrenocortical cells. Int J Mol Med. 2003 May;11(5):613-5.

Additional Infomation
Adrenomedullin (AM) (22-52), human is a research-grade peptide antagonist of adrenomedullin and CGRP receptors. It is an NH2-terminal truncated adrenomedullin analogue with the sequence TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2. The peptide has a molecular formula of C159H252N46O48 and a molecular weight of 3575.98. It is used as a research tool to study the physiological roles of adrenomedullin and CGRP in cardiovascular regulation. Not approved for clinical use.
These protocols are for reference only. InvivoChem does not independently validate these methods.
Physicochemical Properties
Molecular Formula
C121H193N33O31S
Molecular Weight
2638.09464621544
Exact Mass
2637.429
CAS #
159899-65-7
Related CAS #
Adrenomedullin (AM) (22-52), human TFA
PubChem CID
44208916
Appearance
White to off-white solid powder
LogP
-5.6
Hydrogen Bond Donor Count
40
Hydrogen Bond Acceptor Count
38
Rotatable Bond Count
90
Heavy Atom Count
186
Complexity
5620
Defined Atom Stereocenter Count
0
SMILES
S(C)CC[C@@H](C(N[C@@H](C)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](C)C(N[C@@H](C)C(N[C@H](C(N[C@H](C(N)=O)CC(C)C)=O)C(C)C)=O)=O)=O)CC(C)C)=O)CC1C=CC(=CC=1)O)=O)CCCCN)=O)CCCCN)=O)C(C)C)=O)=O)NC([C@H](CCC(N)=O)NC([C@H](CCCCN)NC([C@H](CCCNC(=N)N)NC([C@H](CC1C=CC(=CC=1)O)NC([C@H](CCCNC(=N)N)NC([C@H](CO)NC([C@H](CC1C=CC(=CC=1)O)NC([C@H](CO)NC([C@H](CC(=O)O)NC([C@H]([C@@H](C)O)NC([C@H](CC1C=CC=CC=1)N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O
InChi Key
MMCDBQGTKNYEHP-UHFFFAOYSA-N
InChi Code
InChI=1S/C121H193N33O31S/c1-62(2)53-85(98(127)164)144-118(184)96(65(7)8)153-100(166)67(10)134-99(165)66(9)136-110(176)86(54-63(3)4)145-112(178)88(57-72-34-40-75(159)41-35-72)147-107(173)79(28-18-21-48-123)138-105(171)80(29-19-22-49-124)143-117(183)95(64(5)6)152-101(167)68(11)135-103(169)84(46-52-186-13)142-109(175)83(44-45-93(126)161)141-104(170)78(27-17-20-47-122)137-106(172)81(30-23-50-132-120(128)129)139-111(177)87(56-71-32-38-74(158)39-33-71)146-108(174)82(31-24-51-133-121(130)131)140-115(181)91(60-155)150-113(179)89(58-73-36-42-76(160)43-37-73)148-116(182)92(61-156)151-114(180)90(59-94(162)163)149-119(185)97(69(12)157)154-102(168)77(125)55-70-25-15-14-16-26-70/h14-16,25-26,32-43,62-69,77-92,95-97,155-160H,17-24,27-31,44-61,122-125H2,1-13H3,(H2,126,161)(H2,127,164)(H,134,165)(H,135,169)(H,136,176)(H,137,172)(H,138,171)(H,139,177)(H,140,181)(H,141,170)(H,142,175)(H,143,183)(H,144,184)(H,145,178)(H,146,174)(H,147,173)(H,148,182)(H,149,185)(H,150,179)(H,151,180)(H,152,167)(H,153,166)(H,154,168)(H,162,163)(H4,128,129,132)(H4,130,131,133)
Chemical Name
4-[[1-[[1-[[1-[[1-[[1-[[1-[[6-amino-1-[[5-amino-1-[[1-[[1-[[1-[[6-amino-1-[[6-amino-1-[[1-[[1-[[1-[[1-[[1-[(1-amino-4-methyl-1-oxopentan-2-yl)amino]-3-methyl-1-oxobutan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1-oxopropan-2-yl]amino]-4-methylsulfanyl-1-oxobutan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-[[2-[(2-amino-3-phenylpropanoyl)amino]-3-hydroxybutanoyl]amino]-4-oxobutanoic acid
HS Tariff Code
2934.99.9001
Storage

Powder      -20°C    3 years

                     4°C     2 years

In solvent   -80°C    6 months

                  -20°C    1 month

Note: Please store this product in a sealed and protected environment, avoid exposure to moisture.
Shipping Condition
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
Solubility Data
Solubility (In Vitro)
DMSO : ~100 mg/mL (~27.96 mM)
H2O : ~50 mg/mL (~13.98 mM)
Solubility (In Vivo)
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.

Injection Formulations
(e.g. IP/IV/IM/SC)
Injection Formulation 1: DMSO : Tween 80: Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution 50 μL Tween 80 850 μL Saline)
*Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution.
Injection Formulation 2: DMSO : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO 400 μLPEG300 50 μL Tween 80 450 μL Saline)
Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO 900 μL Corn oil)
Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals).
View More

Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO 900 μL (20% SBE-β-CD in saline)]
*Preparation of 20% SBE-β-CD in Saline (4°C,1 week): Dissolve 2 g SBE-β-CD in 10 mL saline to obtain a clear solution.
Injection Formulation 5: 2-Hydroxypropyl-β-cyclodextrin : Saline = 50 : 50 (i.e. 500 μL 2-Hydroxypropyl-β-cyclodextrin 500 μL Saline)
Injection Formulation 6: DMSO : PEG300 : castor oil : Saline = 5 : 10 : 20 : 65 (i.e. 50 μL DMSO 100 μLPEG300 200 μL castor oil 650 μL Saline)
Injection Formulation 7: Ethanol : Cremophor : Saline = 10: 10 : 80 (i.e. 100 μL Ethanol 100 μL Cremophor 800 μL Saline)
Injection Formulation 8: Dissolve in Cremophor/Ethanol (50 : 50), then diluted by Saline
Injection Formulation 9: EtOH : Corn oil = 10 : 90 (i.e. 100 μL EtOH 900 μL Corn oil)
Injection Formulation 10: EtOH : PEG300Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL EtOH 400 μLPEG300 50 μL Tween 80 450 μL Saline)


Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium)
Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose
Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals).
View More

Oral Formulation 3: Dissolved in PEG400
Oral Formulation 4: Suspend in 0.2% Carboxymethyl cellulose
Oral Formulation 5: Dissolve in 0.25% Tween 80 and 0.5% Carboxymethyl cellulose
Oral Formulation 6: Mixing with food powders


Note: Please be aware that the above formulations are for reference only. InvivoChem strongly recommends customers to read literature methods/protocols carefully before determining which formulation you should use for in vivo studies, as different compounds have different solubility properties and have to be formulated differently.

 (Please use freshly prepared in vivo formulations for optimal results.)
Preparing Stock Solutions 1 mg 5 mg 10 mg
1 mM 0.3791 mL 1.8953 mL 3.7906 mL
5 mM 0.0758 mL 0.3791 mL 0.7581 mL
10 mM 0.0379 mL 0.1895 mL 0.3791 mL

*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.

Calculator

Molarity Calculator allows you to calculate the mass, volume, and/or concentration required for a solution, as detailed below:

  • Calculate the Mass of a compound required to prepare a solution of known volume and concentration
  • Calculate the Volume of solution required to dissolve a compound of known mass to a desired concentration
  • Calculate the Concentration of a solution resulting from a known mass of compound in a specific volume
An example of molarity calculation using the molarity calculator is shown below:
What is the mass of compound required to make a 10 mM stock solution in 5 ml of DMSO given that the molecular weight of the compound is 350.26 g/mol?
  • Enter 350.26 in the Molecular Weight (MW) box
  • Enter 10 in the Concentration box and choose the correct unit (mM)
  • Enter 5 in the Volume box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 17.513 mg appears in the Mass box. In a similar way, you may calculate the volume and concentration.

Dilution Calculator allows you to calculate how to dilute a stock solution of known concentrations. For example, you may Enter C1, C2 & V2 to calculate V1, as detailed below:

What volume of a given 10 mM stock solution is required to make 25 ml of a 25 μM solution?
Using the equation C1V1 = C2V2, where C1=10 mM, C2=25 μM, V2=25 ml and V1 is the unknown:
  • Enter 10 into the Concentration (Start) box and choose the correct unit (mM)
  • Enter 25 into the Concentration (End) box and select the correct unit (mM)
  • Enter 25 into the Volume (End) box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 62.5 μL (0.1 ml) appears in the Volume (Start) box
g/mol

Molecular Weight Calculator allows you to calculate the molar mass and elemental composition of a compound, as detailed below:

Note: Chemical formula is case sensitive: C12H18N3O4  c12h18n3o4
Instructions to calculate molar mass (molecular weight) of a chemical compound:
  • To calculate molar mass of a chemical compound, please enter the chemical/molecular formula and click the “Calculate’ button.
Definitions of molecular mass, molecular weight, molar mass and molar weight:
  • Molecular mass (or molecular weight) is the mass of one molecule of a substance and is expressed in the unified atomic mass units (u). (1 u is equal to 1/12 the mass of one atom of carbon-12)
  • Molar mass (molar weight) is the mass of one mole of a substance and is expressed in g/mol.
/

Reconstitution Calculator allows you to calculate the volume of solvent required to reconstitute your vial.

  • Enter the mass of the reagent and the desired reconstitution concentration as well as the correct units
  • Click the “Calculate” button
  • The answer appears in the Volume (to add to vial) box
In vivo Formulation Calculator (Clear solution)
Step 1: Enter information below (Recommended: An additional animal to make allowance for loss during the experiment)
Step 2: Enter in vivo formulation (This is only a calculator, not the exact formulation for a specific product. Please contact us first if there is no in vivo formulation in the solubility section.)
+
+
+

Calculation results

Working concentration mg/mL;

Method for preparing DMSO stock solution mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.

Method for preparing in vivo formulation:Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O,mix and clarify.

(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
             (2) Be sure to add the solvent(s) in order.

Contact Us