| Size | Price | |
|---|---|---|
| 500mg | ||
| 1g | ||
| Other Sizes |
| ln Vitro |
In contrast, ACTH inhibits the induction of glutamate (100 μM), NMDA (1 mM), AMPA (50 μM), and kainic acid (25) Excitotoxic neuronal death in neurons at doses of 100–400 nM. In every instance, 400 nM of ACTH offered sufficient defense. Neurons were protected from quinolinic acid (25 μM) by ACTH at 200 or 400 nM. Additionally, 2 μM H2O2, which produces reactive oxygen species (ROS), was unable to cause cell death. 400 nM ACTH proved to be substantially more protective than 200 nM. While ACTH does not protect against the gradual release of NOC-18, it does offer some protection against the quick release of nitric oxide (NO) from NOC-12. Neurons are shielded from the cytotoxic effects of staurosporine (10–20 nM), a well-known inducer of cell death via apoptosis, by ACTH (200 or 400 nM). Cell death is decreased by ACTH from 80% to 55%[1].
|
|---|---|
| ln Vivo |
Icv injection of ACTH significantly reduced cumulative food consumption during the observation period compared with the saline/IgG group. The anorexic effects of ACTH are eliminated when ACTH Ab is injected into the PVN. Food intake was dramatically reduced cumulatively in rats receiving α-MSH Ab into the PVN and ACTH icv, and food intake was the same as in the group treated with ACTH icv and IgG into the PVN. When compared to animals treated with IgG, the cumulative food intake of PVNs considerably increased with injection of either α-MSH Ab or ACTH Ab; however, the administration of both antibodies together did not result in a further rise in food consumption [2].
|
| References |
|
| Molecular Formula |
C14H9BRN2O2
|
|---|---|
| Molecular Weight |
317.137462377548
|
| CAS # |
77465-10-2
|
| Related CAS # |
Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA
|
| PubChem CID |
24188570
|
| Sequence |
Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-PheSYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
|
| SequenceShortening |
SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
|
| Appearance |
White to off-white solid
|
| Hydrogen Bond Donor Count |
3
|
| Hydrogen Bond Acceptor Count |
5
|
| Rotatable Bond Count |
4
|
| Heavy Atom Count |
10
|
| Complexity |
95.8
|
| Defined Atom Stereocenter Count |
0
|
| HS Tariff Code |
2934.99.9001
|
| Storage |
Powder -20°C 3 years 4°C 2 years In solvent -80°C 6 months -20°C 1 month Note: Please store this product in a sealed and protected environment, avoid exposure to moisture. |
| Shipping Condition |
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
|
| Solubility (In Vitro) |
DMSO: ~25 mg/mL (~5.5 mM; with ultrasonication)
|
|---|---|
| Solubility (In Vivo) |
Note: Listed below are some common formulations that may be used to formulate products with low water solubility (e.g. < 1 mg/mL), you may test these formulations using a minute amount of products to avoid loss of samples.
Injection Formulations
Injection Formulation 1: DMSO : Tween 80: Saline = 10 : 5 : 85 (i.e. 100 μL DMSO stock solution → 50 μL Tween 80 → 850 μL Saline)(e.g. IP/IV/IM/SC) *Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH ₂ O to obtain a clear solution. Injection Formulation 2: DMSO : PEG300 :Tween 80 : Saline = 10 : 40 : 5 : 45 (i.e. 100 μL DMSO → 400 μLPEG300 → 50 μL Tween 80 → 450 μL Saline) Injection Formulation 3: DMSO : Corn oil = 10 : 90 (i.e. 100 μL DMSO → 900 μL Corn oil) Example: Take the Injection Formulation 3 (DMSO : Corn oil = 10 : 90) as an example, if 1 mL of 2.5 mg/mL working solution is to be prepared, you can take 100 μL 25 mg/mL DMSO stock solution and add to 900 μL corn oil, mix well to obtain a clear or suspension solution (2.5 mg/mL, ready for use in animals). View More
Injection Formulation 4: DMSO : 20% SBE-β-CD in saline = 10 : 90 [i.e. 100 μL DMSO → 900 μL (20% SBE-β-CD in saline)] Oral Formulations
Oral Formulation 1: Suspend in 0.5% CMC Na (carboxymethylcellulose sodium) Oral Formulation 2: Suspend in 0.5% Carboxymethyl cellulose Example: Take the Oral Formulation 1 (Suspend in 0.5% CMC Na) as an example, if 100 mL of 2.5 mg/mL working solution is to be prepared, you can first prepare 0.5% CMC Na solution by measuring 0.5 g CMC Na and dissolve it in 100 mL ddH2O to obtain a clear solution; then add 250 mg of the product to 100 mL 0.5% CMC Na solution, to make the suspension solution (2.5 mg/mL, ready for use in animals). View More
Oral Formulation 3: Dissolved in PEG400  (Please use freshly prepared in vivo formulations for optimal results.) |
| Preparing Stock Solutions | 1 mg | 5 mg | 10 mg | |
| 1 mM | 3.1532 mL | 15.7659 mL | 31.5318 mL | |
| 5 mM | 0.6306 mL | 3.1532 mL | 6.3064 mL | |
| 10 mM | 0.3153 mL | 1.5766 mL | 3.1532 mL |
*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.
Calculation results
Working concentration: mg/mL;
Method for preparing DMSO stock solution: mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.
Method for preparing in vivo formulation::Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O,mix and clarify.
(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
(2) Be sure to add the solvent(s) in order.