yingweiwo

Echistatin TFA

Cat No.:V77051 Purity: ≥98%
Echistatin TFA is originally the smallest RGD active protein from the echistatin family and is a potent inhibitor of platelet aggregation.
Echistatin TFA
Echistatin TFA Chemical Structure Product category: Integrin
This product is for research use only, not for human use. We do not sell to patients.
Size Price Stock Qty
1mg
Other Sizes

Other Forms of Echistatin TFA:

  • Echistatin
Official Supplier of:
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Top Publications Citing lnvivochem Products
Product Description
Echistatin TFA is originally the smallest RGD active protein from the echistatin family and is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in vitro. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1.
Echistatin TFA is the smallest active RGD-containing disintegrin protein derived from snake venom (Echis carinatus), which potently inhibits platelet aggregation and bone resorption by antagonizing integrin receptors.
Biological Activity I Assay Protocols (From Reference)
Targets
αvβ3 α5β1 αIIbβ3
Integrins alphaIIbbeta3, alphavbeta3, and alpha5beta1; functions as a potent antagonist, blocking integrin-mediated cell adhesion, platelet aggregation, and osteoclast-mediated bone resorption.
ln Vitro
Echistatin TFA is a potent inhibitor of platelet aggregation, with an IC50 in the low nanomolar range (0.1-1 nM) against alphaIIbbeta3. It also potently inhibits bone resorption in culture (osteoclast assays) and blocks cell adhesion to vitronectin and fibronectin by antagonizing alphavbeta3 and alpha5beta1 integrins.
ln Vivo
Echistatin TFA inhibits platelet aggregation in vivo when administered intravenously in animal models. It has been shown to inhibit tumor cell metastasis and angiogenesis by blocking integrin-mediated cell adhesion and migration in murine models.
Enzyme Assay
Integrin binding affinity is assessed by competitive ELISA: microtiter plates are coated with purified alphaIIbbeta3, alphavbeta3, or alpha5beta1; Echistatin (0.001-100 nM) competes with biotinylated fibronectin or vitronectin; binding is detected with streptavidin-HRP. IC50 values are determined from displacement curves.
Cell Assay
Human platelets or HUVEC cells are pre-incubated with Echistatin TFA (0.1-100 nM) for 15-30 min; platelet aggregation is induced by ADP or thrombin and measured by aggregometry; osteoclasts are cultured on bone slices with Echistatin; resorption pits are visualized by toluidine blue staining.
Animal Protocol
Mice are injected intravenously with Echistatin TFA (0.1-1 mg/kg) 10-15 min before tumor cell injection in metastasis models. Platelet aggregation is measured by bleeding time; tumor cell adhesion to endothelium is assessed by intravital microscopy; lung metastasis colonies are counted.
ADME/Pharmacokinetics
Not applicable; as a disintegrin peptide, Echistatin TFA has a very short plasma half-life (minutes) due to rapid renal clearance and proteolytic degradation. It is typically used in acute ex vivo and in vivo studies rather than as a therapeutic.
Toxicity/Toxicokinetics
No dedicated toxicity data for the TFA salt. Snake venom disintegrins at high doses can cause bleeding diathesis due to platelet aggregation inhibition. At research doses, toxicity is minimal. For research use only, not for human administration.
References

[1]. Inhibition of platelet adhesion to surfaces of extracorporeal circuits by disintegrins. RGD-containing peptides from viper venoms. Circulation. 1990 Jul;82(1):261-73.

[2]. Echistatin is a potent inhibitor of bone resorption in culture. J Cell Biol. 1990 Oct;111(4):1713-23.

[3]. Biochemical characterization of the binding of echistatin to integrin alphavbeta3 receptor. J Pharmacol Exp Ther. 1997 Nov;283(2):843-53.

[4]. Structural requirements of echistatin for the recognition of alpha(v)beta(3) and alpha(5)beta(1) integrins. J Biol Chem. 1999 Dec 31;274(53):37809-14.

Additional Infomation
Echistatin TFA is a research-grade tool for studying integrin biology, platelet aggregation, bone resorption, angiogenesis, and tumor metastasis. It has no clinical trial status or marketing approval as a therapeutic agent. For research use only.
These protocols are for reference only. InvivoChem does not independently validate these methods.
Physicochemical Properties
Molecular Formula
C219H342F3N71O76S9
Molecular Weight
5531.02
Related CAS #
Echistatin;154303-05-6
Sequence
Glu-Cys-Glu-Ser-Gly-Pro-Cys-Cys-Arg-Asn-Cys-Lys-Phe-Leu-Lys-Glu-Gly-Thr-Ile-Cys-Lys-Arg-Ala-Arg-Gly-Asp-Asp-Met-Asp-Asp-Tyr-Cys-Asn-Gly-Lys-Thr-Cys-Asp-Cys-Pro-Arg-Asn-Pro-His-Lys-Gly-Pro-Ala-Thr (Disulfide bridge:Cys2-Cys11;Cys7-Cys32;Cys8-Cys37;Cys20-Cys39)ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT (Disulfide bridge:Cys2-Cys11;Cys7-Cys32;Cys8-Cys37;Cys20-Cys39)
SequenceShortening
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT (Disulfide bridge:Cys2-Cys11;Cys7-Cys32;Cys8-Cys37;Cys20-Cys39)
Appearance
White to off-white solid powder
Source
Originated from animals: snake venoms
HS Tariff Code
2934.99.9001
Storage

Powder      -20°C    3 years

                     4°C     2 years

In solvent   -80°C    6 months

                  -20°C    1 month

Note: Please store this product in a sealed and protected environment, avoid exposure to moisture.
Shipping Condition
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
Solubility Data
Solubility (In Vitro)
H2O :~50 mg/mL (~9.04 mM)
Solubility (In Vivo)
Solubility in Formulation 1: 50 mg/mL (9.04 mM) in PBS (add these co-solvents sequentially from left to right, and one by one), clear solution; with sonication.

 (Please use freshly prepared in vivo formulations for optimal results.)
Preparing Stock Solutions 1 mg 5 mg 10 mg
1 mM 0.1808 mL 0.9040 mL 1.8080 mL
5 mM 0.0362 mL 0.1808 mL 0.3616 mL
10 mM 0.0181 mL 0.0904 mL 0.1808 mL

*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.

Calculator

Molarity Calculator allows you to calculate the mass, volume, and/or concentration required for a solution, as detailed below:

  • Calculate the Mass of a compound required to prepare a solution of known volume and concentration
  • Calculate the Volume of solution required to dissolve a compound of known mass to a desired concentration
  • Calculate the Concentration of a solution resulting from a known mass of compound in a specific volume
An example of molarity calculation using the molarity calculator is shown below:
What is the mass of compound required to make a 10 mM stock solution in 5 ml of DMSO given that the molecular weight of the compound is 350.26 g/mol?
  • Enter 350.26 in the Molecular Weight (MW) box
  • Enter 10 in the Concentration box and choose the correct unit (mM)
  • Enter 5 in the Volume box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 17.513 mg appears in the Mass box. In a similar way, you may calculate the volume and concentration.

Dilution Calculator allows you to calculate how to dilute a stock solution of known concentrations. For example, you may Enter C1, C2 & V2 to calculate V1, as detailed below:

What volume of a given 10 mM stock solution is required to make 25 ml of a 25 μM solution?
Using the equation C1V1 = C2V2, where C1=10 mM, C2=25 μM, V2=25 ml and V1 is the unknown:
  • Enter 10 into the Concentration (Start) box and choose the correct unit (mM)
  • Enter 25 into the Concentration (End) box and select the correct unit (mM)
  • Enter 25 into the Volume (End) box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 62.5 μL (0.1 ml) appears in the Volume (Start) box
g/mol

Molecular Weight Calculator allows you to calculate the molar mass and elemental composition of a compound, as detailed below:

Note: Chemical formula is case sensitive: C12H18N3O4  c12h18n3o4
Instructions to calculate molar mass (molecular weight) of a chemical compound:
  • To calculate molar mass of a chemical compound, please enter the chemical/molecular formula and click the “Calculate’ button.
Definitions of molecular mass, molecular weight, molar mass and molar weight:
  • Molecular mass (or molecular weight) is the mass of one molecule of a substance and is expressed in the unified atomic mass units (u). (1 u is equal to 1/12 the mass of one atom of carbon-12)
  • Molar mass (molar weight) is the mass of one mole of a substance and is expressed in g/mol.
/

Reconstitution Calculator allows you to calculate the volume of solvent required to reconstitute your vial.

  • Enter the mass of the reagent and the desired reconstitution concentration as well as the correct units
  • Click the “Calculate” button
  • The answer appears in the Volume (to add to vial) box
In vivo Formulation Calculator (Clear solution)
Step 1: Enter information below (Recommended: An additional animal to make allowance for loss during the experiment)
Step 2: Enter in vivo formulation (This is only a calculator, not the exact formulation for a specific product. Please contact us first if there is no in vivo formulation in the solubility section.)
+
+
+

Calculation results

Working concentration: mg/mL;

Method for preparing DMSO stock solution: mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.

Method for preparing in vivo formulation::Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O,mix and clarify.

(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
             (2) Be sure to add the solvent(s) in order.

Contact Us