yingweiwo

Prolactin Releasing Peptide (1-31), human acetate

Cat No.:V76605 Purity: ≥98%
Prolactin Releasing Peptide (1-31), human (acetate) is a high-affinity GPR10 ligand that induces the release of prolactin.
Prolactin Releasing Peptide (1-31), human acetate
Prolactin Releasing Peptide (1-31), human acetate Chemical Structure Product category: Peptides
This product is for research use only, not for human use. We do not sell to patients.
Size Price Stock Qty
1mg
5mg
Other Sizes

Other Forms of Prolactin Releasing Peptide (1-31), human acetate:

  • Prolactin-Releasing Peptide (1-31) (human)
Official Supplier of:
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Top Publications Citing lnvivochem Products
Product Description
Prolactin Releasing Peptide (1-31), human (acetate) is a high-affinity GPR10 ligand that induces the release of prolactin. Prolactin Releaving Peptide (1-31) binds human and rat GPR10 with Kis of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) may be utilized in studies of the hypothalamic-pituitary axis.
Prolactin Releasing Peptide (1-31), human acetate is a 31-amino acid peptide that acts as a high-affinity ligand for the prolactin-releasing peptide receptor (GPR10). It belongs to the RFamide peptide family and is primarily expressed in the hypothalamus. The acetate salt form ensures stability and solubility, making it suitable for research into prolactin-related disorders, metabolism, and neuroendocrine functions.
Biological Activity I Assay Protocols (From Reference)
Targets
Prolactin Releasing Peptide (1-31), human acetate targets the GPR10 (prolactin-releasing peptide receptor), a member of the G protein-coupled receptor (GPCR) family. By binding to GPR10, this peptide causes the release of the prolactin. It is a high-affinity GPR10 ligand, binding to human and rat GPR10 with Ki values of 1.03 nM and 0.33 nM, respectively.
ln Vitro
Prolactin Releasing Peptide(1-31), human (acetate), has a Ki value of 0.33 nM for rats and 1.03 nM for humans when it binds to GPR10[1].
In vitro, Prolactin Releasing Peptide (1-31), human acetate functions as a high-affinity GPR10 ligand, causing the release of prolactin. It binds to human and rat GPR10 with Ki values of 1.03 nM and 0.33 nM, respectively. The peptide is a potent agonist at the GPR10 receptor and can be used to study the hypothalamo-pituitary axis.
ln Vivo
In vitro, prolactin-releasing peptide (1-31), human (acetate) (ICV, 5 nM) enhances total plasma testosterone, plasma FSH, and LHRH release from hypothalamic explants[2]. Prolactin Releasing Peptide (1-31) (human) (ICV, 100 nM) raises the levels of galanin, vasoactive intestinal peptide (VIP), and hypothalamic peptides implicated in pituitary hormone release, but it had no effect on the secretion of orexin A[2].
In vivo, Prolactin Releasing Peptide (1-31), human acetate induces the release of prolactin. When administered via intracerebroventricular (ICV) injection at 5 nM, it increases plasma FSH, total plasma testosterone, and significantly increases plasma prolactin levels. It is a high-affinity GPR10 ligand that causes the release of prolactin.
Enzyme Assay
A cell-free binding assay for Prolactin Releasing Peptide (1-31) would involve a competition binding experiment using membranes from cells expressing the GPR10 receptor. Membranes are incubated with a radiolabeled ligand (e.g., ¹2⁵I-PrRP31) and increasing concentrations of the unlabeled peptide. Bound radioligand is separated by filtration, and the IC50 and Ki values are calculated.
Cell Assay
GH3 cells (rat pituitary tumor cells) are seeded in 24-well plates in DMEM + 10% FBS. After 48 hours, cells are treated with Prolactin Releasing Peptide (1-31), human acetate (0.01 nM to 1 uM). Supernatants are collected after a specified time, and prolactin levels are measured by ELISA. The EC50 for prolactin release can be calculated. cAMP levels in cell lysates can also be measured.
Animal Protocol
A standard in vivo protocol for Prolactin Releasing Peptide involves its use in rodent studies. Male Wistar rats (200-250 g) are anesthetized and a cannula is implanted into the lateral ventricle for ICV administration. After recovery, rats receive an ICV injection of the peptide (5-500 nM). Blood samples are collected via the jugular vein at various times, and plasma prolactin levels are measured by ELISA.
ADME/Pharmacokinetics
Prolactin Releasing Peptide (1-31), human acetate has a molecular weight of 3724.17 and the sequence SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2. The peptide is supplied as a powder that should be stored at -80degC for up to 2 years. In solvent, it is stable for 6 months at -80degC. For in vivo use, it can be formulated in 10% DMSO/PBS.
Toxicity/Toxicokinetics
Detailed toxicity data for Prolactin Releasing Peptide (1-31), human acetate are not available. As a naturally occurring peptide, it is expected to have low toxicity at physiological concentrations. Standard laboratory safety precautions for handling peptides should be followed. Use appropriate PPE to avoid inhalation or skin contact.
References

[1]. Characterization of the binding of [(125)I]-human prolactin releasing peptide (PrRP) to GPR10, a novel G protein coupled receptor. Characterization of the binding of [(125)I]-human prolactin releasing peptide (PrRP) to GPR10, a novel G protein coupled receptor.

[2]. Prolactin releasing peptide (PrRP) stimulates luteinizing hormone (LH) and follicle stimulating hormone (FSH) via a hypothalamic mechanism in male rats. Endocrinology. 2000 May;141(5):1909-12.

Additional Infomation
Prolactin Releasing Peptide (1-31), human acetate is a high-affinity GPR10 ligand. This product is for research use only and is not approved for therapeutic use in humans. It is a valuable tool for studying prolactin-related disorders, metabolism, and neuroendocrine functions. The acetate form ensures stability and solubility for research applications.
These protocols are for reference only. InvivoChem does not independently validate these methods.
Physicochemical Properties
Molecular Formula
C162H26N56O44S
Molecular Weight
3724.17
Related CAS #
Prolactin Releasing Peptide (1-31), human;215510-22-8
Appearance
Solid powder
HS Tariff Code
2934.99.9001
Storage

Powder      -20°C    3 years

                     4°C     2 years

In solvent   -80°C    6 months

                  -20°C    1 month

Note: Please store this product in a sealed and protected environment (e.g. under nitrogen), avoid exposure to moisture and light.
Shipping Condition
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
Solubility Data
Solubility (In Vitro)
DMSO :~12.5 mg/mL (~3.36 mM)
Solubility (In Vivo)
Solubility in Formulation 1: 1.25 mg/mL (0.34 mM) in 10% DMSO + 40% PEG300 + 5% Tween80 + 45% Saline (add these co-solvents sequentially from left to right, and one by one), clear solution; with sonication.
For example, if 1 mL of working solution is to be prepared, you can add 100 μL of 12.5 mg/mL clear DMSO stock solution to 400 μL PEG300 and mix evenly; then add 50 μL Tween-80 to the above solution and mix evenly; then add 450 μL normal saline to adjust the volume to 1 mL.
Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH₂ O to obtain a clear solution.

Solubility in Formulation 2: 1.25 mg/mL (0.34 mM) in 10% DMSO + 90% (20% SBE-β-CD in Saline) (add these co-solvents sequentially from left to right, and one by one), clear solution; with ultrasonication.
For example, if 1 mL of working solution is to be prepared, you can add 100 μL of 12.5 mg/mL clear DMSO stock solution to 900 μL of 20% SBE-β-CD physiological saline solution and mix evenly.
Preparation of 20% SBE-β-CD in Saline (4°C,1 week): Dissolve 2 g SBE-β-CD in 10 mL saline to obtain a clear solution.

 (Please use freshly prepared in vivo formulations for optimal results.)
Preparing Stock Solutions 1 mg 5 mg 10 mg
1 mM 0.2685 mL 1.3426 mL 2.6852 mL
5 mM 0.0537 mL 0.2685 mL 0.5370 mL
10 mM 0.0269 mL 0.1343 mL 0.2685 mL

*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.

Calculator

Molarity Calculator allows you to calculate the mass, volume, and/or concentration required for a solution, as detailed below:

  • Calculate the Mass of a compound required to prepare a solution of known volume and concentration
  • Calculate the Volume of solution required to dissolve a compound of known mass to a desired concentration
  • Calculate the Concentration of a solution resulting from a known mass of compound in a specific volume
An example of molarity calculation using the molarity calculator is shown below:
What is the mass of compound required to make a 10 mM stock solution in 5 ml of DMSO given that the molecular weight of the compound is 350.26 g/mol?
  • Enter 350.26 in the Molecular Weight (MW) box
  • Enter 10 in the Concentration box and choose the correct unit (mM)
  • Enter 5 in the Volume box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 17.513 mg appears in the Mass box. In a similar way, you may calculate the volume and concentration.

Dilution Calculator allows you to calculate how to dilute a stock solution of known concentrations. For example, you may Enter C1, C2 & V2 to calculate V1, as detailed below:

What volume of a given 10 mM stock solution is required to make 25 ml of a 25 μM solution?
Using the equation C1V1 = C2V2, where C1=10 mM, C2=25 μM, V2=25 ml and V1 is the unknown:
  • Enter 10 into the Concentration (Start) box and choose the correct unit (mM)
  • Enter 25 into the Concentration (End) box and select the correct unit (mM)
  • Enter 25 into the Volume (End) box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 62.5 μL (0.1 ml) appears in the Volume (Start) box
g/mol

Molecular Weight Calculator allows you to calculate the molar mass and elemental composition of a compound, as detailed below:

Note: Chemical formula is case sensitive: C12H18N3O4  c12h18n3o4
Instructions to calculate molar mass (molecular weight) of a chemical compound:
  • To calculate molar mass of a chemical compound, please enter the chemical/molecular formula and click the “Calculate’ button.
Definitions of molecular mass, molecular weight, molar mass and molar weight:
  • Molecular mass (or molecular weight) is the mass of one molecule of a substance and is expressed in the unified atomic mass units (u). (1 u is equal to 1/12 the mass of one atom of carbon-12)
  • Molar mass (molar weight) is the mass of one mole of a substance and is expressed in g/mol.
/

Reconstitution Calculator allows you to calculate the volume of solvent required to reconstitute your vial.

  • Enter the mass of the reagent and the desired reconstitution concentration as well as the correct units
  • Click the “Calculate” button
  • The answer appears in the Volume (to add to vial) box
In vivo Formulation Calculator (Clear solution)
Step 1: Enter information below (Recommended: An additional animal to make allowance for loss during the experiment)
Step 2: Enter in vivo formulation (This is only a calculator, not the exact formulation for a specific product. Please contact us first if there is no in vivo formulation in the solubility section.)
+
+
+

Calculation results

Working concentration mg/mL;

Method for preparing DMSO stock solution mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.

Method for preparing in vivo formulation:Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O,mix and clarify.

(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
             (2) Be sure to add the solvent(s) in order.

Contact Us