| Size | Price | Stock | Qty |
|---|---|---|---|
| 1mg |
|
||
| 5mg |
|
||
| Other Sizes |
| Targets |
Prolactin Releasing Peptide (1-31), human acetate targets the GPR10 (prolactin-releasing peptide receptor), a member of the G protein-coupled receptor (GPCR) family. By binding to GPR10, this peptide causes the release of the prolactin. It is a high-affinity GPR10 ligand, binding to human and rat GPR10 with Ki values of 1.03 nM and 0.33 nM, respectively.
|
|---|---|
| ln Vitro |
Prolactin Releasing Peptide(1-31), human (acetate), has a Ki value of 0.33 nM for rats and 1.03 nM for humans when it binds to GPR10[1].
In vitro, Prolactin Releasing Peptide (1-31), human acetate functions as a high-affinity GPR10 ligand, causing the release of prolactin. It binds to human and rat GPR10 with Ki values of 1.03 nM and 0.33 nM, respectively. The peptide is a potent agonist at the GPR10 receptor and can be used to study the hypothalamo-pituitary axis. |
| ln Vivo |
In vitro, prolactin-releasing peptide (1-31), human (acetate) (ICV, 5 nM) enhances total plasma testosterone, plasma FSH, and LHRH release from hypothalamic explants[2]. Prolactin Releasing Peptide (1-31) (human) (ICV, 100 nM) raises the levels of galanin, vasoactive intestinal peptide (VIP), and hypothalamic peptides implicated in pituitary hormone release, but it had no effect on the secretion of orexin A[2].
In vivo, Prolactin Releasing Peptide (1-31), human acetate induces the release of prolactin. When administered via intracerebroventricular (ICV) injection at 5 nM, it increases plasma FSH, total plasma testosterone, and significantly increases plasma prolactin levels. It is a high-affinity GPR10 ligand that causes the release of prolactin. |
| Enzyme Assay |
A cell-free binding assay for Prolactin Releasing Peptide (1-31) would involve a competition binding experiment using membranes from cells expressing the GPR10 receptor. Membranes are incubated with a radiolabeled ligand (e.g., ¹2⁵I-PrRP31) and increasing concentrations of the unlabeled peptide. Bound radioligand is separated by filtration, and the IC50 and Ki values are calculated.
|
| Cell Assay |
GH3 cells (rat pituitary tumor cells) are seeded in 24-well plates in DMEM + 10% FBS. After 48 hours, cells are treated with Prolactin Releasing Peptide (1-31), human acetate (0.01 nM to 1 uM). Supernatants are collected after a specified time, and prolactin levels are measured by ELISA. The EC50 for prolactin release can be calculated. cAMP levels in cell lysates can also be measured.
|
| Animal Protocol |
A standard in vivo protocol for Prolactin Releasing Peptide involves its use in rodent studies. Male Wistar rats (200-250 g) are anesthetized and a cannula is implanted into the lateral ventricle for ICV administration. After recovery, rats receive an ICV injection of the peptide (5-500 nM). Blood samples are collected via the jugular vein at various times, and plasma prolactin levels are measured by ELISA.
|
| ADME/Pharmacokinetics |
Prolactin Releasing Peptide (1-31), human acetate has a molecular weight of 3724.17 and the sequence SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2. The peptide is supplied as a powder that should be stored at -80degC for up to 2 years. In solvent, it is stable for 6 months at -80degC. For in vivo use, it can be formulated in 10% DMSO/PBS.
|
| Toxicity/Toxicokinetics |
Detailed toxicity data for Prolactin Releasing Peptide (1-31), human acetate are not available. As a naturally occurring peptide, it is expected to have low toxicity at physiological concentrations. Standard laboratory safety precautions for handling peptides should be followed. Use appropriate PPE to avoid inhalation or skin contact.
|
| References |
|
| Additional Infomation |
Prolactin Releasing Peptide (1-31), human acetate is a high-affinity GPR10 ligand. This product is for research use only and is not approved for therapeutic use in humans. It is a valuable tool for studying prolactin-related disorders, metabolism, and neuroendocrine functions. The acetate form ensures stability and solubility for research applications.
|
| Molecular Formula |
C162H26N56O44S
|
|---|---|
| Molecular Weight |
3724.17
|
| Related CAS # |
Prolactin Releasing Peptide (1-31), human;215510-22-8
|
| Appearance |
Solid powder
|
| HS Tariff Code |
2934.99.9001
|
| Storage |
Powder -20°C 3 years 4°C 2 years In solvent -80°C 6 months -20°C 1 month Note: Please store this product in a sealed and protected environment (e.g. under nitrogen), avoid exposure to moisture and light. |
| Shipping Condition |
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
|
| Solubility (In Vitro) |
DMSO :~12.5 mg/mL (~3.36 mM)
|
|---|---|
| Solubility (In Vivo) |
Solubility in Formulation 1: 1.25 mg/mL (0.34 mM) in 10% DMSO + 40% PEG300 + 5% Tween80 + 45% Saline (add these co-solvents sequentially from left to right, and one by one), clear solution; with sonication.
For example, if 1 mL of working solution is to be prepared, you can add 100 μL of 12.5 mg/mL clear DMSO stock solution to 400 μL PEG300 and mix evenly; then add 50 μL Tween-80 to the above solution and mix evenly; then add 450 μL normal saline to adjust the volume to 1 mL. Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH₂ O to obtain a clear solution. Solubility in Formulation 2: 1.25 mg/mL (0.34 mM) in 10% DMSO + 90% (20% SBE-β-CD in Saline) (add these co-solvents sequentially from left to right, and one by one), clear solution; with ultrasonication. For example, if 1 mL of working solution is to be prepared, you can add 100 μL of 12.5 mg/mL clear DMSO stock solution to 900 μL of 20% SBE-β-CD physiological saline solution and mix evenly. Preparation of 20% SBE-β-CD in Saline (4°C，1 week): Dissolve 2 g SBE-β-CD in 10 mL saline to obtain a clear solution. (Please use freshly prepared in vivo formulations for optimal results.) |
| Preparing Stock Solutions | 1 mg | 5 mg | 10 mg | |
| 1 mM | 0.2685 mL | 1.3426 mL | 2.6852 mL | |
| 5 mM | 0.0537 mL | 0.2685 mL | 0.5370 mL | |
| 10 mM | 0.0269 mL | 0.1343 mL | 0.2685 mL |
*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.
Calculation results
Working concentration： mg/mL；
Method for preparing DMSO stock solution： mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.
Method for preparing in vivo formulation:：Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O，mix and clarify.
(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
(2) Be sure to add the solvent(s) in order.
Products are for research use only; We do not sell to patients
Copyright 2020 InvivoChem LLC | All Rights Reserved
