yingweiwo

Aviptadil acetate (Vasoactive Intestinal Peptide acetate salt (human, rat, mouse, rabbit, canine, porcine))

Alias: Aviptadil; Vasoactive intestinal octacosapeptide; invicorp; Vip human vip; RLF-100; UNII-A67JUW790C; Aviptadil [USAN:INN:BAN]; A67JUW790C;
Cat No.:V76074 Purity: ≥98%
Aviptadil acetate is a vasoactive intestinal polypeptide (VIP) analogue with strong vasodilatory effects.
Aviptadil acetate (Vasoactive Intestinal Peptide acetate salt (human, rat, mouse, rabbit, canine, porcine))
Aviptadil acetate (Vasoactive Intestinal Peptide acetate salt (human, rat, mouse, rabbit, canine, porcine)) Chemical Structure CAS No.: 1444827-29-5
Product category: SARS-CoV
This product is for research use only, not for human use. We do not sell to patients.
Size Price Stock Qty
1mg
5mg
10mg
Other Sizes

Other Forms of Aviptadil acetate (Vasoactive Intestinal Peptide acetate salt (human, rat, mouse, rabbit, canine, porcine)):

  • AVIPTADIL Acetate
Official Supplier of:
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Top Publications Citing lnvivochem Products
Product Description
Aviptadil acetate is a vasoactive intestinal polypeptide (VIP) analogue with strong vasodilatory effects. . Aviptadil acetate induces pulmonary vasodilation and inhibits vascular SMCs proliferation and platelet aggregation. Aviptadil acetate can be used for research on pulmonary fibrosis, pulmonary arterial hypertension (PAH), respiratory failure caused by SARS-CoV-2, etc.
Aviptadil acetate (Vasoactive Intestinal Peptide acetate salt) (CAS#: 1444827-29-5) is an analog of vasoactive intestinal polypeptide (VIP) with potent vasodilatory effects. With a molecular weight of 3385.90 and molecular formula C₁₄₇H₂₃₈N₄₄O₄₂S·C₂H₄O₂, this peptide analog induces pulmonary vasodilation and inhibits vascular smooth muscle cell (SMC) proliferation and platelet aggregation. Aviptadil acetate can be used for the research of pulmonary fibrosis, pulmonary arterial hypertension (PAH), and SARS-CoV-2-caused respiratory failure.
Biological Activity I Assay Protocols (From Reference)
Targets
VIP/vasoactive intestinal polypeptide; vasodilatory
Aviptadil acetate targets vasoactive intestinal peptide (VIP) receptors, which are G protein-coupled receptors widely distributed in the lungs, vasculature, and other tissues. VIP is a neuropeptide with potent vasodilatory, bronchodilatory, and immunomodulatory activities. By acting as a VIP analog, Aviptadil acetate activates VIP receptors, leading to increased intracellular cAMP levels, smooth muscle relaxation, and vasodilation. The compound also inhibits vascular smooth muscle cell proliferation and platelet aggregation, contributing to its therapeutic effects in pulmonary vascular diseases.
ln Vitro
In L2 cells, aviptadil acetate (1 nM–10 μM) inhibits CSE-induced cell death in a concentration-dependent manner. Aviptadil acetate inhibits caspase-3 activation and CSE-stimulated MMP activity in L2 cells at 10 μM[1].
Aviptadil, a synthetic form of Human Vasoactive Intestinal Polypeptide (VIP) has been awarded FDA Orphan Drug Designation for the treatment of ARDS and admitted to the FDA CoronaVirus Technology Accelerator Program. VIP binds to VPAC1 receptors on the pulmonary Alveolar Type II (ATII) cell. ATII cells comprise only 5% of lung epithelial cells but are critical for oxygen transfer, surfactant production, and maintenance of Alveolar Type 1 cells. 70% of VIP binds to this receptor. The Type II cell is also the cell selectively attacked by the SARS-CoV-2 virus via the ACE2 surface receptor. [1]
In vitro, Aviptadil acetate induces pulmonary vasodilation and inhibits vascular smooth muscle cell (SMC) proliferation and platelet aggregation. As a VIP analog, the compound activates VIP receptors and increases intracellular cAMP levels, leading to smooth muscle relaxation. The compound's ability to inhibit SMC proliferation makes it useful for studying pulmonary arterial hypertension and other vascular proliferative diseases.
ln Vivo
Pulmonary hypertension (PH) leads to an increased right ventricular workload, cardiac failure and death. In idiopathic pulmonary arterial hypertension (PAH) the vasodilating vasoactive intestinal peptide (aviptadil) is deficient. The aim of the present study was to test the acute effects on haemodynamics and blood gases, and the safety, of a single dose of inhaled aviptadil in chronic PH. A total of 20 patients with PH (PAH in nine, PH in lung disease in eight and chronic thromboembolic PH in three) inhaled a single 100-microg dose of aviptadil during right-heart catheterisation. Haemodynamics and blood gases were measured. Aviptadil aerosol caused a small and temporary but significant selective pulmonary vasodilation, an improved stroke volume and mixed venous oxygen saturation. Overall, six patients experienced a pulmonary vascular resistance reduction of >20%. In patients with significant lung disease, aviptadil tended to improve oxygenation. The pulmonary vasodilating effect of aviptadil aerosol was modest and short-lived, did not cause any side-effects and led to a reduced workload of the right ventricle without affecting systemic blood pressure. Aviptadil inhalation tended to improve oxygenation in patients with significant lung disease. Further studies are needed to evaluate the full therapeutic potential of aviptadil aerosol, including higher doses and chronic treatment. [5]
In vivo, Aviptadil acetate can be used for the research of pulmonary fibrosis, pulmonary arterial hypertension (PAH), and SARS-CoV-2-caused respiratory failure. The compound's potent vasodilatory effects and ability to modulate pulmonary vascular tone make it a valuable tool for studying pulmonary diseases. In the context of SARS-CoV-2 infection, Aviptadil acetate may help alleviate respiratory failure by improving pulmonary blood flow and reducing inflammation.
Enzyme Assay
For non-cellular in vitro receptor binding assays, Aviptadil acetate is evaluated for its binding affinity to VIP receptors (VPAC1 and VPAC2) using radioligand binding assays or surface plasmon resonance. The compound is incubated with membrane preparations expressing VIP receptors, and binding affinity is determined. The compound's ability to activate VIP receptors and increase cAMP production may be assessed in cell-free systems.
Cell Assay
For in vitro cellular assays, Aviptadil acetate is tested in vascular smooth muscle cell cultures to assess its effects on cell proliferation. Cells are treated with the compound, and proliferation is measured using standard assays such as BrdU incorporation or cell counting. The compound's effects on platelet aggregation are assessed in platelet-rich plasma by measuring aggregation in response to agonists. The compound's ability to induce vasodilation may be assessed in isolated blood vessel preparations.
Animal Protocol
Acute Lung Injury, which triggers Critical COVID-19 is a known lethal complication of Corona Virus (SARS-CoV-2) infection. Conventional medical therapy, including intensive care and respiratory support is associated with an 80% mortality. Aviptadil, a synthetic form of Human Vasoactive Intestinal Polypeptide (VIP) has been awarded FDA Orphan Drug Designation for the treatment of ARDS and admitted to the FDA CoronaVirus Technology Accelerator Program. VIP binds to VPAC1 receptors on the pulmonary Alveolar Type II (ATII) cell. ATII cells comprise only 5% of lung epithelial cells but are critical for oxygen transfer, surfactant production, and maintenance of Alveolar Type 1 cells. 70% of VIP binds to this receptor. The Type II cell is also the cell selectively attacked by the SARS-CoV-2 virus via the ACE2 surface receptor. Nonclinical studies demonstrate that VIP is highly concentrated in the lung and specifically bound to the ATII cell, where it prevents NMDA-induced caspase-3 activation in the lung, inhibits IL6 and TNFa production, protects against HCl-induced pulmonary edema, and upregulates surfactant production, These and other effects have been observed in numerous animal model systems of lung injury in mice, rats, guinea pigs, sheep, swine, and dogs. In these models, Aviptadil restores barrier function at the endothelial/alveolar interface and thereby protects the lung and other organs from failure. Aviptadil ihas a demonstrated 20 year history of safety in phase 2 trials for Sarcoid, Pulmonary Fibrosis, Bronchospasm, and a phase I trial in ARDS. In that phase I trial, 8 patients with severe ARDS on mechanical ventilation were treated with ascending doses of VIP. Seven of the 8 patients were successfully extubated and were alive at the five day timepoint. Six left the hospital and one died of an unrelated cardiac event. Five phase 2 trials of aviptadil have been conducted under European regulatory authority. Numerous healthy volunteer studies have shown that i.v. infusion of Aviptadil is well tolerated with few adverse effects including alterations in blood pressure, heart rate, or ECG. In addition to published studies of human use, Aviptadil has been used on a compounded basis in certain ICUs for many years in the belief that it preserves life and restores function in pulmonary hypertension, ARDS, and Acute Lung Injury (ALI). In this study, patients who are hospitalized for Critical COVID-19 infection with respiratory failure will be randomly allocated to Aviptadil administered by intravenous infusion in addition to maximal intensive care vs. maximal intensive care alone. Primary endpoints will be improvement in blood oxygenation and mortality. [1]
For in vivo animal studies, Aviptadil acetate is evaluated in animal models of pulmonary fibrosis, pulmonary arterial hypertension, and respiratory failure. Mice or rats are treated with the compound via intravenous or other routes of administration. Pulmonary function, hemodynamic parameters, and histological changes are assessed to evaluate the compound's efficacy. In SARS-CoV-2 models, the compound's effects on respiratory function and survival are assessed.
ADME/Pharmacokinetics
Pharmacokinetic data for Aviptadil acetate are limited. As a peptide with a molecular weight of 3385.90, it is expected to have limited oral bioavailability and is typically administered via intravenous or other parenteral routes. The compound's half-life is likely short due to rapid degradation by peptidases. Further pharmacokinetic studies would be needed to fully characterize its absorption, distribution, metabolism, and excretion profile. The compound is for research use only and not for human use outside of clinical trials.
Toxicity/Toxicokinetics
Toxicological data for Aviptadil acetate are limited. As a VIP analog, the compound may have dose-dependent effects on cardiovascular and pulmonary function. Comprehensive toxicology studies would be required for therapeutic development. The compound is for research use only and not for human use outside of clinical trials.
References

[1]. Intravenous Aviptadil for Critical COVID-19 With Respiratory Failure (COVID-AIV).

[2]. Novel Targets of Drug Treatment for Pulmonary Hypertension. Am J Cardiovasc Drugs.

[3]. VIP and endothelin receptor antagonist: an effective combination against experimental pulmonary arterial hypertension. Respir Res. 2011;12(1):141.

[4]. Vasoactive intestinal peptide ameliorates reperfusion injury in rat lung transplantation. J Heart Lung Transplant. 1998;17(6):617-621.

Additional Infomation
Avicardil is a synthetic vasoactive intestinal peptide (VIP) with potential anti-cytokine, anti-inflammatory, and immunomodulatory activities. After administration, avicardil mimics the effects of endogenous VIP. In the lungs, avicardil may inhibit N-methyl-D-aspartate (NMDA)-induced caspase-3 activation, suppress the production of certain pro-inflammatory mediators such as interleukin-6 (IL-6) and tumor necrosis factor-α (TNF-α), and may protect the lungs from cytokine storms and inflammation. Since cytokines cause alveoli to fill with water, making them impermeable to oxygen, avicardil may help prevent pulmonary edema and restore the barrier function of the endothelial/alveolar interface. This may improve blood oxygenation, alleviate respiratory distress, and prevent lung injury. VIP is a naturally occurring synthetic peptide hormone that is highly enriched in the lungs.
AVIPTADIL is a protein drug that has completed Phase III clinical trials (covering all indications) and has four investigational indications.
Advances in biomedicine over the past decade have revealed the central role of proliferating pulmonary artery smooth muscle cells (PASMCs) in the development of pulmonary hypertension (PH). Furthermore, research has identified factors promoting PASMC and endothelial cell proliferation and anti-apoptosis, such as aberrant signaling pathways involving growth factors, G protein-coupled receptors, kinases, and microRNAs. Based on these findings, PH is now classified into different subtypes according to underlying pathology, allowing for more targeted treatments. PH is characterized by dysplastic PASMC proliferation, local inflammation, and endothelial cell anti-apoptosis, all of which ultimately lead to vascular wall remodeling. Several promising targets have been identified to assess the relative contributions of these factors. This review discusses new targets for PH treatment developed in recent years based on these advances, which are currently in preclinical and clinical trial phases (e.g., imatinib [Phase III]; nilotinib, AT-877ER, rituximab, tacrolimus, paroxetine, sertraline, fluoxetine, bardoxolone methyl ester [Phase II]; and sorafenib, FK506, avipadil, endothelial progenitor cells (EPCs) [Phase I]). Despite significant progress in targeting key molecular pathways in recent years, pulmonary arterial hypertension (PH) remains incurable. These novel therapies provide an important conceptual framework for classifying patients based on molecular phenotypes to achieve effective treatment of the disease. [2]
Background: Treatment of pulmonary arterial hypertension (PAH) remains challenging, and more effective drugs and drug combinations are still being explored. We recently reported that deletion of the vasoactive intestinal peptide (VIP) gene leads to spontaneous expression of the PH phenotype, which VIP can completely correct. This study aims to answer the following questions: 1) Can VIP prevent PH in other experimental models? 2) Does the combined use of vasoactive intestinal peptide (VIP) and the endothelin (ET) receptor antagonist bosentan enhance its efficacy? Methods: Pulmonary hypertension (PAH) was induced in Sprague Dawley rats within 3 weeks following a single subcutaneous injection of monoclonal antibody (MCT), characterized by pulmonary vascular remodeling, pulmonary inflammation, and right ventricular hypertrophy, leading to death within the next 2 weeks. Animals in the MCT injection group received one of the following treatments: no treatment, oral bosentan alone, intraperitoneal VIP alone, or a combination therapy. This combination therapy was chosen because VIP downregulates endothelin receptor expression, while bosentan further inhibits endothelin receptor expression. Hemodynamics, pulmonary vascular pathology, and survival rates were compared among the treatment groups. Results: VIP treatment, initiated on the same day as the MCT injection and administered every other day for 3 weeks, almost completely halted the pathological progression of PAH and eliminated deaths within 45 days. However, VIP treatment initiated 3 weeks after MCT treatment, while more effective than bosentan, only partially reversed the pathological changes of PAH. The combined treatment of the two drugs completely reversed the pathological changes and prevented death for at least 45 days. Conclusions: 1) VIP can completely prevent and significantly reverse MCT-induced PAH; 2) VIP is more effective than bosentan, possibly because it targets a wider range of pro-remodeling pathways; 3) VIP combined with bosentan is more effective than either drug alone, possibly because the two drugs synergistically inhibit the ET-ET receptor pathway. [3]
Background: Vasoactive intestinal peptide (VIP) has been reported to have some protective properties against lung damage. In addition, its protective effect in cold preservation of donor lungs has been confirmed. We used an in vivo rat lung transplantation model to study the effects of VIP and the timing of its administration. Methods: All lungs were flushed with low-potassium dextran-1% glucose solution and orthotopically transplanted with the left lung. Rats were divided into four groups (n=6). The first group did not undergo any preservation treatment. The transplanted lungs in the second, third and fourth groups were preserved at 4°C for 18 hours. The second group did not receive VIP treatment. The third group received VIP (0.1 g/ml) via flushing solution. Recipients in group IV received an intravenous injection of VIP (3 μg/kg) immediately after reperfusion. Twenty-four hours post-transplantation, the right pulmonary artery and right bronchus were ligated, and the recipients were ventilated with 100% oxygen for 5 minutes. Mean pulmonary artery pressure, peak airway pressure, blood gas analysis, serum lipid peroxidation levels, tissue myeloperoxidase activity, and wet/dry weight ratio were measured. Results: The partial pressure of oxygen in groups III and IV was better than that in group II (Groups II, III, and IV: 147.4±71.4, 402.1±64.8, 373.4±81.0 mmHg; p<0.05). The peak airway pressure in groups III and IV was lower than that in group II (Groups II, III, and IV: 19.7±0.8, 16.7±0.9, and 16.3±1.0 mmHg; p<0.05). The mean pulmonary artery pressure in the third group was lower than that in the second group (Group 2 and Group 3: 36.3±3.0 and 22.1±2.2 mmHg; p<0.01). The wet weight/dry weight ratio in the third group was lower than that in the second and fourth groups (Group 2, Group 3 and Group 4: 5.2±0.2, 4.4±0.2 and 5.2±0.3; Group 2 vs. Group 3: p<0.05, Group 3 vs. Group 4: p<0.01). The serum lipid peroxide levels in the third and fourth groups were significantly lower than those in the other groups (Group 2, Group 3 and Group 4: 2.643 ± 0.913, 0.455 ± 0.147 and 0.325 ± 0.124 nmol/ml, respectively; p < 0.01). Conclusion: VIP can improve reperfusion injury in an in vivo rat lung transplantation model. Whether administered via flushing fluid or immediately after reperfusion, VIP can improve lung function. [4]
Aviptadil acetate is an analog of vasoactive intestinal polypeptide (VIP) with potent vasodilatory effects. The compound induces pulmonary vasodilation and inhibits vascular smooth muscle cell proliferation and platelet aggregation. Aviptadil acetate can be used for the research of pulmonary fibrosis, pulmonary arterial hypertension (PAH), and SARS-CoV-2-caused respiratory failure. The compound has a molecular weight of 3385.90 and molecular formula C₁₄₇H₂₃₈N₄₄O₄₂S·C₂H₄O₂.
These protocols are for reference only. InvivoChem does not independently validate these methods.
Physicochemical Properties
Molecular Formula
C149H242N44O44S
Molecular Weight
3385.84921216965
Exact Mass
3384.78
CAS #
1444827-29-5
Related CAS #
Aviptadil;40077-57-4
PubChem CID
91820620
Sequence
HSDAVFTDNYTRLRKQMAVKKYLNSILN
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
L-histidyl-L-seryl-L-alpha-aspartyl-L-alanyl-L-valyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-asparagyl-L-tyrosyl-L-threonyl-L-arginyl-L-leucyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-asparagyl-L-seryl-L-isoleucyl-L-leucyl-L-asparagine
SequenceShortening
H-HSDAVFTDNYTRLRKQMAVKKYLNSILN-OH
Appearance
White to off-white solid powder
Hydrogen Bond Donor Count
52
Hydrogen Bond Acceptor Count
52
Rotatable Bond Count
115
Heavy Atom Count
238
Complexity
7610
Defined Atom Stereocenter Count
31
SMILES
CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)N)C(=O)N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC2=CC=C(C=C2)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@H](C(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC4=CN=CN4)N.CC(=O)O
InChi Key
ZPFJSONBPCXUTA-JEBDDVQLSA-N
InChi Code
InChI=1S/C147H238N44O42S.C2H4O2/c1-18-75(12)115(143(231)182-97(56-72(6)7)131(219)174-94(118(156)206)61-108(153)199)189-140(228)106(68-193)186-135(223)102(63-110(155)201)179-132(220)96(55-71(4)5)176-133(221)98(58-81-37-41-84(196)42-38-81)177-126(214)88(33-23-26-49-149)168-124(212)89(34-24-27-50-150)172-141(229)113(73(8)9)187-119(207)76(13)165-122(210)93(47-53-234-17)171-128(216)92(45-46-107(152)198)170-123(211)87(32-22-25-48-148)167-125(213)90(35-28-51-162-146(157)158)169-130(218)95(54-70(2)3)175-127(215)91(36-29-52-163-147(159)160)173-144(232)116(78(15)194)190-137(225)99(59-82-39-43-85(197)44-40-82)178-134(222)101(62-109(154)200)180-136(224)104(65-112(204)205)184-145(233)117(79(16)195)191-138(226)100(57-80-30-20-19-21-31-80)183-142(230)114(74(10)11)188-120(208)77(14)166-129(217)103(64-111(202)203)181-139(227)105(67-192)185-121(209)86(151)60-83-66-161-69-164-83;1-2(3)4/h19-21,30-31,37-44,66,69-79,86-106,113-117,192-197H,18,22-29,32-36,45-65,67-68,148-151H2,1-17H3,(H2,152,198)(H2,153,199)(H2,154,200)(H2,155,201)(H2,156,206)(H,161,164)(H,165,210)(H,166,217)(H,167,213)(H,168,212)(H,169,218)(H,170,211)(H,171,216)(H,172,229)(H,173,232)(H,174,219)(H,175,215)(H,176,221)(H,177,214)(H,178,222)(H,179,220)(H,180,224)(H,181,227)(H,182,231)(H,183,230)(H,184,233)(H,185,209)(H,186,223)(H,187,207)(H,188,208)(H,189,228)(H,190,225)(H,191,226)(H,202,203)(H,204,205)(H4,157,158,162)(H4,159,160,163);1H3,(H,3,4)/t75-,76-,77-,78+,79+,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,113-,114-,115-,116-,117-;/m0./s1
Chemical Name
acetic acid;(3S)-4-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S,3R)-1-[[(2S)-1-[[(2S)-4-amino-1-[[(2S)-1-[[(2S,3R)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-4-amino-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-1,4-diamino-1,4-dioxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1-oxopropan-2-yl]amino]-4-methylsulfanyl-1-oxobutan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-[[(2S)-2-[[(2S)-2-amino-3-(1H-imidazol-5-yl)propanoyl]amino]-3-hydroxypropanoyl]amino]-4-oxobutanoic acid
Synonyms
Aviptadil; Vasoactive intestinal octacosapeptide; invicorp; Vip human vip; RLF-100; UNII-A67JUW790C; Aviptadil [USAN:INN:BAN]; A67JUW790C;
HS Tariff Code
2934.99.9001
Storage

Powder      -20°C    3 years

                     4°C     2 years

In solvent   -80°C    6 months

                  -20°C    1 month

Note: Please store this product in a sealed and protected environment (e.g. under nitrogen), avoid exposure to moisture and light.
Shipping Condition
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
Solubility Data
Solubility (In Vitro)
H2O: 100 mg/mL (29.53 mM)
DMSO: 100 mg/mL (29.53 mM)
Solubility (In Vivo)
Solubility in Formulation 1: ≥ 2.5 mg/mL (0.74 mM) (saturation unknown) in 10% DMSO + 40% PEG300 + 5% Tween80 + 45% Saline (add these co-solvents sequentially from left to right, and one by one), clear solution.
For example, if 1 mL of working solution is to be prepared, you can add 100 μL of 25.0 mg/mL clear DMSO stock solution to 400 μL PEG300 and mix evenly; then add 50 μL Tween-80 to the above solution and mix evenly; then add 450 μL normal saline to adjust the volume to 1 mL.
Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH₂ O to obtain a clear solution.

Solubility in Formulation 2: 2.5 mg/mL (0.74 mM) in 10% DMSO + 90% (20% SBE-β-CD in Saline) (add these co-solvents sequentially from left to right, and one by one), suspension solution; with ultrasonication.
For example, if 1 mL of working solution is to be prepared, you can add 100 μL of 25.0 mg/mL clear DMSO stock solution to 900 μL of 20% SBE-β-CD physiological saline solution and mix evenly.
Preparation of 20% SBE-β-CD in Saline (4°C,1 week): Dissolve 2 g SBE-β-CD in 10 mL saline to obtain a clear solution.

View More

Solubility in Formulation 3: ≥ 2.5 mg/mL (0.74 mM) (saturation unknown) in 10% DMSO + 90% Corn Oil (add these co-solvents sequentially from left to right, and one by one), clear solution.
For example, if 1 mL of working solution is to be prepared, you can add 100 μL of 25.0 mg/mL clear DMSO stock solution to 900 μL of corn oil and mix evenly.


Solubility in Formulation 4: 50 mg/mL (14.77 mM) in PBS (add these co-solvents sequentially from left to right, and one by one), clear solution; with ultrasonication.

 (Please use freshly prepared in vivo formulations for optimal results.)
Preparing Stock Solutions 1 mg 5 mg 10 mg
1 mM 0.2953 mL 1.4767 mL 2.9535 mL
5 mM 0.0591 mL 0.2953 mL 0.5907 mL
10 mM 0.0295 mL 0.1477 mL 0.2953 mL

*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.

Calculator

Molarity Calculator allows you to calculate the mass, volume, and/or concentration required for a solution, as detailed below:

  • Calculate the Mass of a compound required to prepare a solution of known volume and concentration
  • Calculate the Volume of solution required to dissolve a compound of known mass to a desired concentration
  • Calculate the Concentration of a solution resulting from a known mass of compound in a specific volume
An example of molarity calculation using the molarity calculator is shown below:
What is the mass of compound required to make a 10 mM stock solution in 5 ml of DMSO given that the molecular weight of the compound is 350.26 g/mol?
  • Enter 350.26 in the Molecular Weight (MW) box
  • Enter 10 in the Concentration box and choose the correct unit (mM)
  • Enter 5 in the Volume box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 17.513 mg appears in the Mass box. In a similar way, you may calculate the volume and concentration.

Dilution Calculator allows you to calculate how to dilute a stock solution of known concentrations. For example, you may Enter C1, C2 & V2 to calculate V1, as detailed below:

What volume of a given 10 mM stock solution is required to make 25 ml of a 25 μM solution?
Using the equation C1V1 = C2V2, where C1=10 mM, C2=25 μM, V2=25 ml and V1 is the unknown:
  • Enter 10 into the Concentration (Start) box and choose the correct unit (mM)
  • Enter 25 into the Concentration (End) box and select the correct unit (mM)
  • Enter 25 into the Volume (End) box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 62.5 μL (0.1 ml) appears in the Volume (Start) box
g/mol

Molecular Weight Calculator allows you to calculate the molar mass and elemental composition of a compound, as detailed below:

Note: Chemical formula is case sensitive: C12H18N3O4  c12h18n3o4
Instructions to calculate molar mass (molecular weight) of a chemical compound:
  • To calculate molar mass of a chemical compound, please enter the chemical/molecular formula and click the “Calculate’ button.
Definitions of molecular mass, molecular weight, molar mass and molar weight:
  • Molecular mass (or molecular weight) is the mass of one molecule of a substance and is expressed in the unified atomic mass units (u). (1 u is equal to 1/12 the mass of one atom of carbon-12)
  • Molar mass (molar weight) is the mass of one mole of a substance and is expressed in g/mol.
/

Reconstitution Calculator allows you to calculate the volume of solvent required to reconstitute your vial.

  • Enter the mass of the reagent and the desired reconstitution concentration as well as the correct units
  • Click the “Calculate” button
  • The answer appears in the Volume (to add to vial) box
In vivo Formulation Calculator (Clear solution)
Step 1: Enter information below (Recommended: An additional animal to make allowance for loss during the experiment)
Step 2: Enter in vivo formulation (This is only a calculator, not the exact formulation for a specific product. Please contact us first if there is no in vivo formulation in the solubility section.)
+
+
+

Calculation results

Working concentration mg/mL;

Method for preparing DMSO stock solution mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.

Method for preparing in vivo formulation:Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O,mix and clarify.

(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
             (2) Be sure to add the solvent(s) in order.

Clinical Trial Information
I-SPY COVID-19 TRIAL: An Adaptive Platform Trial for Critically Ill Patients
CTID: NCT04488081
Phase: Phase 2
Status: Recruiting
Date: 2024-03-19
ACTIV-3b: Therapeutics for Severely Ill Inpatients With COVID-19
CTID: NCT04843761
Phase: Phase 3
Status: Completed
Date: 2023-05-03
A randomized, prospective, multicenter, controlled and double-blinded Phase II Clinical Trial to evaluate the influence of inhaled Aviptadil on Cough and Quality of Life in Sarcoidosis patients
EudraCT: 2017-004219-37
Phase: Phase 2
Status: Completed
Date: 2021-03-16
Double-blind, randomized, placebo-controlled, dose-finding, parallel-group study to assess the hemodynamic effects, clinical efficacy, tolerability and safety of Aviptadil (Vasoactive Intestinal Peptide) after single and repeated inhalation in patients with pulmonary arterial hypertension.
EudraCT: 2007-003621-24
Phase: Phase 2
Status: Prematurely Ended, Completed
Date: 2008-05-29
Contact Us