yingweiwo

Avexitide

Alias: Exendin 9-39; Avexitide Free Base; Exendin (9-39); Avexitide; Exendin-3 (9-39); Asp-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TR; p; -LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2; ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-; Exendin-(9-39)
Cat No.:V33194 Purity: ≥98%
Avexitide [Exendin-3 (9-39)] is a novel, competitive and peptidic antagonist of glucagon-like peptide-1 (GLP-1) receptor with a Kd of 1.7 nM at cloned human GLP-1 receptors.
Avexitide
Avexitide Chemical Structure CAS No.: 133514-43-9
Product category: GCGR
This product is for research use only, not for human use. We do not sell to patients.
Size Price Stock Qty
1mg
5mg
10mg
Other Sizes

Other Forms of Avexitide:

  • Exendin(9-39) amide acetate
Official Supplier of:
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Alternate Text
Top Publications Citing lnvivochem Products
Product Description
Avexitide [Exendin-3 (9-39)] is a novel, competitive and peptidic antagonist of glucagon-like peptide-1 (GLP-1) receptor with a Kd of 1.7 nM at cloned human GLP-1 receptors. Exendin (9–39) blocks the release of insulin and the synthesis of cAMP that is triggered by GLP-1 (7–36), exendin-3, and exendin-4.
Biological Activity I Assay Protocols (From Reference)
Targets
GLP-1 receptor
Avexitide (Exendin-(9-39)) is a specific glucagon-like peptide-1 receptor (GLP-1R) antagonist. [1]
ln Vitro
GLP-1 is involved in the regulation of fasting glucose. Avexitide (also known as Exendin (9-39)) is a particular GLP-1 receptor antagonist that is derived from a shortened version of the GLP-1 agonist exendin-4[1].
In isolated pancreatic islets from neonates with KATPHI, Avexitide (at 100 nmol/L) significantly inhibited insulin secretion stimulated by a physiologic mixture of amino acids (4 mmol/L). Amino acid stimulation alone caused a fourfold increase in insulin secretion, and this increase was significantly reduced by pretreatment with Avexitide. [1]
ln Vivo
In SUR-1 -/- mice, continuous subcutaneous infusion of Avexitide (Exendin (9-39)) dramatically increases fasting blood glucose levels without compromising glucose tolerance[2].
In a randomized, crossover pilot study involving nine subjects with KATPHI, continuous intravenous infusion of Avexitide during a prolonged fast significantly elevated fasting blood glucose levels compared to vehicle infusion.
The mean nadir blood glucose concentration was significantly higher during Avexitide infusion (4.9 ± 1.1 mmol/L) compared to vehicle (3.5 ± 0.3 mmol/L).
The mean blood glucose area under the curve (AUC) from 0 to 360 minutes was significantly greater during Avexitide infusion (2096 ± 454 mmol·min/L) than during vehicle infusion (1678 ± 281 mmol·min/L).
Hypoglycemia (blood glucose <3.9 mmol/L) occurred in eight subjects during vehicle infusion, with three requiring dextrose rescue. No subject developed hypoglycemia during Avexitide infusion.
The insulin-to-glucose AUC ratio was significantly lower during infusion of Avexitide at the higher doses (300 and 500 pmol/kg/min) compared to vehicle, indicating a relative reduction in insulin secretion relative to glucose levels.
Plasma concentrations of glucagon and intact GLP-1 were not significantly affected by Avexitide treatment. [1]
Enzyme Assay
cAMP Content Determination—Islets were isolated as above, hand-picked, and cultured for 3 days. Cultured islets were preincubated in glucose-free Krebs-Ringer bicarbonate buffer for 60 min, and 100 nm exendin-(9–39) was added 30 min into the preincubation period. Then, islets were exposed to different treatments for an additional 30 min in the presence of 0.1 mm isobutylmethylzanthine. After incubation, islets were washed two times by cold glucose-free Hanks' buffer. cAMP was measured in islet lysates by an enzyme-linked immunosorbent assay[2].
Cytosolic Free Ca2+ Measurements—Mouse islets were isolated and cultured on poly-l-lysine-coated glass coverslips under the same conditions as described above. The perifusion procedure and cytosolic-free Ca2+ ([Ca2+]i) measurement were described previously. In brief, the coverslip with attached islets was incubated with 15 μm Fura-2 acetoxymethylester in Krebs-Ringer bicarbonate buffer with 5 mm glucose for 35 min at 37 °C. Islets were then perifused with Krebs-Ringer bicarbonate buffer with 0.25% bovine serum albumin at 37 °C at a flow rate of 2 ml/min while various agents were applied. [Ca2+]i was measured with a dual wavelength fluorescence microscope as previously described[2].
Cell Assay
Islet Studies—Islets were isolated by collagenase digestion and cultured for 3 days in RPMI 1640 medium containing 10 mm glucose. The culture medium was supplemented with 10% fetal bovine serum, 2 mm glutamine, 100 units/ml penicillin, and 50 μg/ml streptomycin. Islets were incubated at 37 °C in a 5% CO2, 95% air-humidified incubator. Batches of 100 cultured mouse islets were loaded onto a nylon filter in a chamber and perifused with Krebs-Ringer bicarbonate buffer (115 mm NaCl, 24 mm NaHCO3, 5 mm KCl, 1 mm MgCl2, 2.5 mm CaCl2, 10 mm HEPES, pH 7.4) with 0.25% bovine serum albumin at a flow rate of 2 ml/min. Perifusate solutions were gassed with 95% O2, 5% CO2 and maintained at 37 °C. Islets were stimulated with a ramp of amino acids. The mixture of 19 amino acids when used at a maximum concentration of 12 mm (about 3 times physiological concentration) had the following composition: 2 mm glutamine, 1.25 mm alanine, 0.53 mm arginine, 0.11 mm aspartate, 0.27 mm citrulline, 0.35 mm glutamate, 0.85 mm glycine, 0.22 mm histidine, 0.27 mm isoleucine, 0.46 mm leucine, 1.06 mm lysine, 0.14 mm methionine, 0.20 mm ornithine, 0.23 mm phenylalanine, 1 mm proline, 1.62 mm serine, 0.77 mm threonine, 0.21 mm tryptophan, 0.57 mm valine. Samples were collected every minute for insulin assays. Insulin was measured by radioimmunoassay[2].
Human Islet Insulin Secretion Assay: Fresh pancreatic islets were isolated from surgical specimens of three neonates with KATPHI. Islets were cultured for 3 days prior to experiments.
Batches of 50 islets were preincubated in glucose-free Krebs-Ringer bicarbonate buffer for 60 minutes. Avexitide (100 nmol/L) was added 30 minutes into the preincubation period.
Islets were then exposed to stimulation with either 10 mmol/L glucose or a 4 mmol/L mixture of amino acids for a defined period.
The culture media were collected, and insulin concentration was measured by radioimmunoassay to determine the level of insulin secretion. [1]
Animal Protocol
Mice: Avexitide (Exendin (9-39)) or a vehicle (0.9% NaCl, 1% bovine serum albumin) is administered subcutaneously via Alzet miniosmotic pumps for a period of two weeks[2].
Exendin-(9–39) Administration—Alzet miniosmotic pumps were implanted subcutaneously to deliver exendin-(9–39) at a rate of 150 pmol/kg/min or vehicle (0.9% NaCl, 1% bovine serum albumin) for 2 weeks.[2]
Glucose Homeostasis—For determination of fasting blood glucose levels, mice were fasted for 12–16 h. Oral glucose tolerance testing was carried after a 12–16-h fast by administering 2 g/kg of dextrose by oral gavage (feeding needles). For insulin tolerance testing, mice received 0.5 units/kg of insulin intraperitoneally after a 4-h fast. Blood glucose levels were measured using a hand-held glucose meter. Insulin and glucagon were measured by ELISA.[2]
References

[1]. GLP-1 receptor antagonist exendin-(9-39) elevates fasting blood glucose levels in congenital owing to inactivating mutations in the ATP-sensitive K+ channel. Diabetes. 2012 Oct;61(10):2585-91.

[2]. Exendin-(9-39) corrects fasting hypoglycemia in SUR-1-/- mice by lowering cAMP in pancreatic beta-cells and inhibiting secretion. J Biol Chem. 2008 Sep 19;283(38):25786-93.

Additional Infomation
Avexitide is being investigated in the clinical trial NCT02996812 (evaluating the efficacy of a single subcutaneous injection of escalating doses of exenatide 9-39 in patients with post-barbiturative hypoglycemia). Avexitide is a truncated form of the glucagon-like peptide-1 receptor (GLP-1R) agonist exenatide-4, possessing both GLP-1 receptor (GLP-1R) antagonistic and GLP-1R-mediated signal transduction inhibitory activities. After administration, avexitide competitively binds to and inhibits the activity of GLP-1R, thereby inhibiting GLP-1/GLP-1R-mediated signal transduction. This antagonizes the glucagon-inhibiting and insulin-secreting effects of GLP-1. By inhibiting GLP-1-mediated insulin release and reducing postprandial glucagon secretion, exenatide 9-39 can be used to investigate the potential effects of excessive GLP-1 production on food intake, weight loss, and blood glucose levels. GLP-1 receptors are located on pancreatic β cells and are overexpressed in certain tumor cell types. GLP-1 is a gastrointestinal insulin secretion hormone that is released after meals and plays a key role in the regulation of blood glucose levels. See also: Avicivide (note moved to). Avicivide (exenatide-(9-39)) is a truncated form of the GLP-1 agonist exenatide-4 and acts as a competitive GLP-1 receptor antagonist. It may also act as an inverse agonist, inhibiting the ligand-independent basal activity of the GLP-1 receptor. [1] This study aimed to evaluate its potential as a novel therapy for congenital hyperinsulinemia (KATPHI) caused by mutations in the inactivation of the KATP channel, a disease for which there are currently limited effective treatments. [1]
The clinical dosing regimen was a stepwise intravenous infusion: 100 pmol/kg/min for 2 hours; followed by 300 pmol/kg/min for 2 hours; and finally 500 pmol/kg/min for 2 hours. The peptide was dissolved in a 0.9% sodium chloride solution containing 0.25% human serum albumin (final concentration 0.1 mg/mL). [1]
The results indicate that endogenous GLP-1 receptor signaling plays a role in the regulation of fasting blood glucose in KATPHI patients, and GLP-1 receptor antagonists are expected to become a new therapeutic target for the prevention of hypoglycemia in this disease. [1]
These protocols are for reference only. InvivoChem does not independently validate these methods.
Physicochemical Properties
Molecular Formula
C₁₄₉H₂₃₄N₄₀O₄₇S
Molecular Weight
3369.76
Exact Mass
3367.687
Elemental Analysis
C, 53.11; H, 7.00; N, 16.63; O, 22.31; S, 0.95
CAS #
133514-43-9
Related CAS #
2051593-46-3 (acetate); 133514-43-9
PubChem CID
16198321
Sequence
Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
SequenceShortening
DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Appearance
Off-white to pale purple solid powder
Density
1.5±0.1 g/cm3
Index of Refraction
1.671
LogP
-5.88
Hydrogen Bond Donor Count
45
Hydrogen Bond Acceptor Count
52
Rotatable Bond Count
109
Heavy Atom Count
237
Complexity
8000
Defined Atom Stereocenter Count
29
SMILES
[DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2]
InChi Key
WSEVKKHALHSUMB-MVNVRWBSSA-N
InChi Code
InChI=1S/C149H234N40O47S/c1-14-78(10)120(185-139(227)98(62-81-29-16-15-17-30-81)177-136(224)97(61-76(6)7)175-129(217)88(35-24-53-158-149(156)157)172-144(232)119(77(8)9)184-122(210)79(11)164-126(214)90(41-46-114(199)200)168-131(219)91(42-47-115(201)202)169-132(220)92(43-48-116(203)204)170-134(222)94(50-58-237-13)171-130(218)89(40-45-109(153)194)167-127(215)86(33-20-22-51-150)166-140(228)103(72-192)182-137(225)95(59-74(2)3)174-123(211)84(152)64-118(207)208)145(233)173-93(44-49-117(205)206)133(221)178-99(63-82-66-159-85-32-19-18-31-83(82)85)138(226)176-96(60-75(4)5)135(223)165-87(34-21-23-52-151)128(216)179-100(65-110(154)195)124(212)161-67-111(196)160-69-113(198)186-54-25-36-105(186)142(230)183-104(73-193)141(229)181-102(71-191)125(213)162-68-112(197)163-80(12)146(234)188-56-27-38-107(188)148(236)189-57-28-39-108(189)147(235)187-55-26-37-106(187)143(231)180-101(70-190)121(155)209/h15-19,29-32,66,74-80,84,86-108,119-120,159,190-193H,14,20-28,33-65,67-73,150-152H2,1-13H3,(H2,153,194)(H2,154,195)(H2,155,209)(H,160,196)(H,161,212)(H,162,213)(H,163,197)(H,164,214)(H,165,223)(H,166,228)(H,167,215)(H,168,219)(H,169,220)(H,170,222)(H,171,218)(H,172,232)(H,173,233)(H,174,211)(H,175,217)(H,176,226)(H,177,224)(H,178,221)(H,179,216)(H,180,231)(H,181,229)(H,182,225)(H,183,230)(H,184,210)(H,185,227)(H,199,200)(H,201,202)(H,203,204)(H,205,206)(H,207,208)(H4,156,157,158)/t78-,79-,80-,84-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,119-,120-/m0/s1
Chemical Name
(4S)-4-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-5-amino-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-3-carboxypropanoyl]amino]-4-methylpentanoyl]amino]-3-hydroxypropanoyl]amino]hexanoyl]amino]-5-oxopentanoyl]amino]-4-methylsulfanylbutanoyl]amino]-4-carboxybutanoyl]amino]-4-carboxybutanoyl]amino]-5-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-4-amino-1-[[2-[[2-[(2S)-2-[[(2S)-1-[[(2S)-1-[[2-[[(2S)-1-[(2S)-2-[(2S)-2-[(2S)-2-[[(2S)-1-amino-3-hydroxy-1-oxopropan-2-yl]carbamoyl]pyrrolidine-1-carbonyl]pyrrolidine-1-carbonyl]pyrrolidin-1-yl]-1-oxopropan-2-yl]amino]-2-oxoethyl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]carbamoyl]pyrrolidin-1-yl]-2-oxoethyl]amino]-2-oxoethyl]amino]-1,4-dioxobutan-2-yl]amino]-1-oxohexan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1-oxopropan-2-yl]amino]-5-oxopentanoic acid
Synonyms
Exendin 9-39; Avexitide Free Base; Exendin (9-39); Avexitide; Exendin-3 (9-39); Asp-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TR; p; -LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2; ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-; Exendin-(9-39)
HS Tariff Code
2934.99.9001
Storage

Powder      -20°C    3 years

                     4°C     2 years

In solvent   -80°C    6 months

                  -20°C    1 month

Note: Please store this product in a sealed and protected environment, avoid exposure to moisture.
Shipping Condition
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
Solubility Data
Solubility (In Vitro)
H2O: ~50 mg/mL (~14.8 mM)
Solubility (In Vivo)
Solubility in Formulation 1: 100 mg/mL (29.68 mM) in PBS (add these co-solvents sequentially from left to right, and one by one), clear solution; with sonication.

 (Please use freshly prepared in vivo formulations for optimal results.)
Preparing Stock Solutions 1 mg 5 mg 10 mg
1 mM 0.2968 mL 1.4838 mL 2.9676 mL
5 mM 0.0594 mL 0.2968 mL 0.5935 mL
10 mM 0.0297 mL 0.1484 mL 0.2968 mL

*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.

Calculator

Molarity Calculator allows you to calculate the mass, volume, and/or concentration required for a solution, as detailed below:

  • Calculate the Mass of a compound required to prepare a solution of known volume and concentration
  • Calculate the Volume of solution required to dissolve a compound of known mass to a desired concentration
  • Calculate the Concentration of a solution resulting from a known mass of compound in a specific volume
An example of molarity calculation using the molarity calculator is shown below:
What is the mass of compound required to make a 10 mM stock solution in 5 ml of DMSO given that the molecular weight of the compound is 350.26 g/mol?
  • Enter 350.26 in the Molecular Weight (MW) box
  • Enter 10 in the Concentration box and choose the correct unit (mM)
  • Enter 5 in the Volume box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 17.513 mg appears in the Mass box. In a similar way, you may calculate the volume and concentration.

Dilution Calculator allows you to calculate how to dilute a stock solution of known concentrations. For example, you may Enter C1, C2 & V2 to calculate V1, as detailed below:

What volume of a given 10 mM stock solution is required to make 25 ml of a 25 μM solution?
Using the equation C1V1 = C2V2, where C1=10 mM, C2=25 μM, V2=25 ml and V1 is the unknown:
  • Enter 10 into the Concentration (Start) box and choose the correct unit (mM)
  • Enter 25 into the Concentration (End) box and select the correct unit (mM)
  • Enter 25 into the Volume (End) box and choose the correct unit (mL)
  • Click the “Calculate” button
  • The answer of 62.5 μL (0.1 ml) appears in the Volume (Start) box
g/mol

Molecular Weight Calculator allows you to calculate the molar mass and elemental composition of a compound, as detailed below:

Note: Chemical formula is case sensitive: C12H18N3O4  c12h18n3o4
Instructions to calculate molar mass (molecular weight) of a chemical compound:
  • To calculate molar mass of a chemical compound, please enter the chemical/molecular formula and click the “Calculate’ button.
Definitions of molecular mass, molecular weight, molar mass and molar weight:
  • Molecular mass (or molecular weight) is the mass of one molecule of a substance and is expressed in the unified atomic mass units (u). (1 u is equal to 1/12 the mass of one atom of carbon-12)
  • Molar mass (molar weight) is the mass of one mole of a substance and is expressed in g/mol.
/

Reconstitution Calculator allows you to calculate the volume of solvent required to reconstitute your vial.

  • Enter the mass of the reagent and the desired reconstitution concentration as well as the correct units
  • Click the “Calculate” button
  • The answer appears in the Volume (to add to vial) box
In vivo Formulation Calculator (Clear solution)
Step 1: Enter information below (Recommended: An additional animal to make allowance for loss during the experiment)
Step 2: Enter in vivo formulation (This is only a calculator, not the exact formulation for a specific product. Please contact us first if there is no in vivo formulation in the solubility section.)
+
+
+

Calculation results

Working concentration mg/mL;

Method for preparing DMSO stock solution mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.

Method for preparing in vivo formulation:Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O,mix and clarify.

(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
             (2) Be sure to add the solvent(s) in order.

Clinical Trial Information
NCT Number Recruitment interventions Conditions Sponsor/Collaborators Start Date Phases
NCT03373435 Completed Drug: exendin 9-39
Other: Placebo
Postbariatric Hypoglycemia Eiger BioPharmaceuticals March 19, 2018 Phase 2
NCT02971631 Completed Other: Exendin 9-39
Other: Placebo
Gastric Cancer
Dumping Syndrome
Cambridge University Hospitals
NHS Foundation Trust
August 10, 2017 Not Applicable
NCT01795144 Completed Drug: GLP-1
Drug: Exendin 9-39
Monogenic Diabetes University of Chicago January 2014 Phase 1
NCT02336659 Completed Drug: exendin 9-39
Drug: sitagliptin
Severe Obesity Hvidovre University Hospital April 2014 Not Applicable
NCT02771574 Completed Drug: Lyo avexitide
Drug: Liq avexitide
Post Bariatric Hypoglycemia Tracey McLaughlin May 2016 Phase 2
Biological Data
  • Effect of exendin-(9-39) on fasting blood glucose. Diabetes . 2012 Oct;61(10):2585-91.
  • Effect of exendin-(9-39) on fasting plasma insulin. Diabetes . 2012 Oct;61(10):2585-91.
  • Effect of exendin-(9-39) on insulin-to-glucose ratio. Diabetes . 2012 Oct;61(10):2585-91.
Contact Us