| Size | Price | Stock | Qty |
|---|---|---|---|
| 1mg |
|
||
| 5mg |
|
||
| 100mg | |||
| Other Sizes |
| Targets |
The primary targets of Neuropeptide Y(29-64) are the Neuropeptide Y receptors, which are G protein-coupled receptors. The full-length NPY binds to multiple receptor subtypes, including Y1, Y2, Y4, and Y5 receptors, which are involved in various physiological processes such as appetite regulation, anxiety, and cardiovascular function. As a C-terminal fragment, Neuropeptide Y(29-64) may have reduced affinity for these receptors compared to the full-length peptide, but it can still interact with them and modulate their activity. The peptide is used to study the receptor-binding properties of the C-terminal region of NPY and to investigate the structure-activity relationships of NPY and its fragments.
|
|---|---|
| ln Vitro |
Neuropeptide Y(29-64) is a 36-amino acid peptide and fragment of Neuropeptide Y [1].
In vitro, Neuropeptide Y(29-64) is a 36-amino acid peptide fragment of Neuropeptide Y used as a research tool. The peptide's activity is related to its ability to interact with Neuropeptide Y receptors, although its affinity and potency are lower than those of the full-length peptide due to the absence of the N-terminal region, which is important for receptor binding and activation. Neuropeptide Y(29-64) is used in receptor binding studies to map the binding epitopes of NPY and to identify the regions of the peptide that are critical for receptor interaction. It is also used as a standard in analytical methods for studying NPY metabolism. |
| ln Vivo |
In vivo, Neuropeptide Y is a highly conserved neurotransmitter found throughout the central and peripheral nervous systems, involved in regulating appetite, anxiety, and cardiovascular function. As a fragment of NPY, Neuropeptide Y(29-64) may have some of these in vivo effects, although its potency is reduced compared to the full-length peptide. The compound is used in research to study the metabolism and function of NPY in vivo. It is also used as a standard in analytical methods for measuring NPY and its metabolites in biological samples. Further in vivo studies are needed to fully characterize its biological activity.
|
| Enzyme Assay |
The in vitro binding activity of Neuropeptide Y(29-64) can be assessed using receptor binding assays with Neuropeptide Y receptors (e.g., Y1, Y2, Y4, Y5). A typical protocol involves incubating the peptide with membranes from cells expressing the receptor and a radiolabeled NPY ligand (e.g., [125I]-NPY). Bound and free ligand are separated by filtration, and the radioactivity is measured by gamma counting. The IC50 or Ki value is determined by plotting the percentage of specific binding remaining against the peptide concentration. The activity of the peptide can also be assessed using functional assays, such as measuring calcium mobilization or cAMP accumulation in cells expressing the receptors.
|
| Cell Assay |
For in vitro cellular experiments, cells expressing Neuropeptide Y receptors (e.g., transfected cell lines or primary neurons) are cultured in appropriate media and treated with Neuropeptide Y(29-64) at various concentrations (typically 0.1-100 uM). The peptide's ability to activate the receptor is assessed by measuring downstream signaling, such as calcium mobilization using fluorescent calcium indicators (e.g., Fluo-4) or cAMP accumulation using ELISA. The duration of treatment varies depending on the specific assay. The peptide can also be used in competition assays with full-length NPY to determine its relative affinity and potency for different receptor subtypes.
|
| Animal Protocol |
In vivo animal experiments with Neuropeptide Y(29-64) are not commonly performed, as it is a fragment of NPY. However, the peptide can be administered to animals (e.g., rats or mice) via intracerebroventricular or intravenous injection to study its effects on appetite, anxiety, or cardiovascular function. A typical protocol involves administering the peptide at various doses and measuring physiological parameters such as food intake, heart rate, or blood pressure. Blood and tissue samples are collected to measure the levels of the peptide and its metabolites. The peptide is also used as a standard in analytical methods for measuring NPY and its metabolites in biological samples.
|
| ADME/Pharmacokinetics |
Neuropeptide Y(29-64) is a peptide with a molecular weight of 4272.7 g/mol and a molecular formula of C189H284N54O58S. As a peptide, its pharmacokinetic properties are characterized by rapid clearance from the circulation due to proteolytic degradation. The peptide is typically administered by injection in preclinical studies. Its half-life is short, and it is rapidly metabolized by peptidases in the blood and tissues. The peptide is stable in lyophilized form and should be stored at -20degC. It is soluble in DMSO and aqueous buffers. Its pharmacokinetic properties make it suitable for acute pharmacological studies but less suitable for chronic dosing.
|
| Toxicity/Toxicokinetics |
Neuropeptide Y(29-64) is a peptide fragment and is generally considered to have low toxicity. As a naturally occurring peptide fragment, it is expected to be well-tolerated at pharmacological doses. However, high doses may cause alterations in appetite, anxiety, or cardiovascular function due to its interaction with NPY receptors. The compound should be handled with standard laboratory precautions and is intended for research use only.
|
| Additional Infomation |
Neuropeptide Y(29-64) is a 36-amino acid peptide fragment derived from the C-terminal region of the full-length Neuropeptide Y (NPY). It has a molecular weight of 4272.7 g/mol and a sequence of YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY. NPY is a highly conserved neurotransmitter involved in appetite regulation, anxiety, and cardiovascular function. Neuropeptide Y(29-64) is used as a research tool to study the structure-function relationships of NPY and its receptors. It is available as a research compound and is not approved for clinical use.
|
| Molecular Formula |
C189H284N54O58S
|
|---|---|
| Molecular Weight |
4272.70
|
| Exact Mass |
4272.072
|
| CAS # |
303052-45-1
|
| PubChem CID |
137700277
|
| Appearance |
White to off-white solid powder
|
| Hydrogen Bond Donor Count |
63
|
| Hydrogen Bond Acceptor Count |
66
|
| Rotatable Bond Count |
136
|
| Heavy Atom Count |
302
|
| Complexity |
10500
|
| Defined Atom Stereocenter Count |
38
|
| SMILES |
CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)NC(=O)[C@H](CC2=CC=C(C=C2)O)NC(=O)[C@H](CC3=CNC=N3)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC4=CC=C(C=C4)O)NC(=O)[C@H](CC5=CC=C(C=C5)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@@H]6CCCN6C(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@@H]7CCCN7C(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H]8CCCN8C(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H]9CCCN9C(=O)[C@H](CC1=CC=C(C=C1)O)N
|
| InChi Key |
YAJRGCSGUHVGLW-HRPSIEBRSA-N
|
| InChi Code |
InChI=1S/C189H284N54O58S/c1-15-93(7)148(178(293)232-127(81-140(193)253)167(282)224-122(74-92(5)6)170(285)238-149(94(8)16-2)179(294)239-150(99(13)246)180(295)221-115(31-22-67-207-189(201)202)155(270)219-117(56-59-139(192)252)160(275)217-114(30-21-66-206-188(199)200)158(273)234-132(185(300)301)79-104-44-54-110(251)55-45-104)237-171(286)125(78-103-42-52-109(250)53-43-103)227-166(281)126(80-105-86-203-90-209-105)228-157(272)113(29-20-65-205-187(197)198)218-163(278)121(73-91(3)4)223-153(268)96(10)211-172(287)133(88-244)235-165(280)124(77-102-40-50-108(249)51-41-102)226-164(279)123(76-101-38-48-107(248)49-39-101)225-156(271)112(28-19-64-204-186(195)196)215-151(266)95(9)210-154(269)119(62-72-302-14)220-168(283)129(84-146(262)263)230-161(276)118(58-61-144(258)259)216-152(267)97(11)212-175(290)136-33-24-68-240(136)181(296)98(12)213-162(277)128(83-145(260)261)229-159(274)116(57-60-143(256)257)214-142(255)87-208-174(289)135-32-23-70-242(135)184(299)131(82-141(194)254)233-169(284)130(85-147(264)265)231-176(291)138-35-26-71-243(138)183(298)120(27-17-18-63-190)222-173(288)134(89-245)236-177(292)137-34-25-69-241(137)182(297)111(191)75-100-36-46-106(247)47-37-100/h36-55,86,90-99,111-138,148-150,244-251H,15-35,56-85,87-89,190-191H2,1-14H3,(H2,192,252)(H2,193,253)(H2,194,254)(H,203,209)(H,208,289)(H,210,269)(H,211,287)(H,212,290)(H,213,277)(H,214,255)(H,215,266)(H,216,267)(H,217,275)(H,218,278)(H,219,270)(H,220,283)(H,221,295)(H,222,288)(H,223,268)(H,224,282)(H,225,271)(H,226,279)(H,227,281)(H,228,272)(H,229,274)(H,230,276)(H,231,291)(H,232,293)(H,233,284)(H,234,273)(H,235,280)(H,236,292)(H,237,286)(H,238,285)(H,239,294)(H,256,257)(H,258,259)(H,260,261)(H,262,263)(H,264,265)(H,300,301)(H4,195,196,204)(H4,197,198,205)(H4,199,200,206)(H4,201,202,207)/t93-,94-,95-,96-,97-,98-,99+,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,148-,149-,150-/m0/s1
|
| Chemical Name |
(4S)-4-[[2-[[(2S)-1-[(2S)-4-amino-2-[[(2S)-2-[[(2S)-1-[(2S)-6-amino-2-[[(2S)-2-[[(2S)-1-[(2S)-2-amino-3-(4-hydroxyphenyl)propanoyl]pyrrolidine-2-carbonyl]amino]-3-hydroxypropanoyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-3-carboxypropanoyl]amino]-4-oxobutanoyl]pyrrolidine-2-carbonyl]amino]acetyl]amino]-5-[[(2S)-1-[[(2S)-1-[(2S)-2-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-4-amino-1-[[(2S)-1-[[(2S,3S)-1-[[(2S,3R)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-5-carbamimidamido-1-[[(1S)-1-carboxy-2-(4-hydroxyphenyl)ethyl]amino]-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-4-methylsulfanyl-1-oxobutan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-1-oxopropan-2-yl]carbamoyl]pyrrolidin-1-yl]-1-oxopropan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-5-oxopentanoic acid
|
| HS Tariff Code |
2934.99.9001
|
| Storage |
Powder -20°C 3 years 4°C 2 years In solvent -80°C 6 months -20°C 1 month Note: Please store this product in a sealed and protected environment, avoid exposure to moisture. |
| Shipping Condition |
Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)
|
| Solubility (In Vitro) |
DMSO : ~16.67 mg/mL (~3.90 mM)
|
|---|---|
| Solubility (In Vivo) |
Solubility in Formulation 1: ≥ 1.67 mg/mL (0.39 mM) (saturation unknown) in 10% DMSO + 40% PEG300 + 5% Tween80 + 45% Saline (add these co-solvents sequentially from left to right, and one by one), clear solution.
For example, if 1 mL of working solution is to be prepared, you can add 100 μL of 16.7 mg/mL clear DMSO stock solution to 400 μL PEG300 and mix evenly; then add 50 μL Tween-80 to the above solution and mix evenly; then add 450 μL normal saline to adjust the volume to 1 mL. Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH₂ O to obtain a clear solution. Solubility in Formulation 2: ≥ 1.67 mg/mL (0.39 mM) (saturation unknown) in 10% DMSO + 90% (20% SBE-β-CD in Saline) (add these co-solvents sequentially from left to right, and one by one), clear solution. For example, if 1 mL of working solution is to be prepared, you can add 100 μL of 16.7 mg/mL clear DMSO stock solution to 900 μL of 20% SBE-β-CD physiological saline solution and mix evenly. Preparation of 20% SBE-β-CD in Saline (4°C,1 week): Dissolve 2 g SBE-β-CD in 10 mL saline to obtain a clear solution. View More
Solubility in Formulation 3: ≥ 1.67 mg/mL (0.39 mM) (saturation unknown) in 10% DMSO + 90% Corn Oil (add these co-solvents sequentially from left to right, and one by one), clear solution. |
| Preparing Stock Solutions | 1 mg | 5 mg | 10 mg | |
| 1 mM | 0.2340 mL | 1.1702 mL | 2.3404 mL | |
| 5 mM | 0.0468 mL | 0.2340 mL | 0.4681 mL | |
| 10 mM | 0.0234 mL | 0.1170 mL | 0.2340 mL |
*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.
Calculation results
Working concentration: mg/mL;
Method for preparing DMSO stock solution: mg drug pre-dissolved in μL DMSO (stock solution concentration mg/mL). Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug.
Method for preparing in vivo formulation::Take μL DMSO stock solution, next add μL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O,mix and clarify.
(1) Please be sure that the solution is clear before the addition of next solvent. Dissolution methods like vortex, ultrasound or warming and heat may be used to aid dissolving.
(2) Be sure to add the solvent(s) in order.